Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.08
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 0.001
osteosarcoma -1.523 0.000
group 3 medulloblastoma 1.200 0.010

Synonym

Accession Q9Y6V7 E7ENA0 Q53FJ1 Q9BVQ8
Symbols R27090_2

Gene

Gene RIF (2)

PMID Text
22190034 HIV-1 Gag is identified to have a physical interaction with DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 (DDX49) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18976975 Knockdown of DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 (DDX49) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MAGFAELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYG      1 - 70
IFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGRLADHLRSSNT     71 - 140
FSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPFFWEAQ    141 - 210
APVSTVEQLDQRYLLVPEKVKDAYLVHLIQRFQDEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHS    211 - 280
MMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAIT    281 - 350
LVTQYDIHLVHAIEEQIKKKLEEFSVEEAEVLQILTQVNVVRRECEIKLEAAHFDEKKEINKRKQLILEG    351 - 420
KDPDLEAKRKAELAKIKQKNRRFKEKVEETLKRQKAGRAGHKGRPPRTPSGSHSGPVPSQGLV           421 - 483
//

Text Mined References (11)

PMID Year Title
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
More...