Property Summary

NCBI Gene PubMed Count 21
Grant Count 11
R01 Count 6
Funding $1,332,106.51
PubMed Score 86.14
PubTator Score 33.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (5)

PMID Text
25303873 SCIN plays an important role in lung carcinoma cell proliferation
25174406 Suppression of scinderin impairs proliferation and migration of gastric cancer SGC7901 cells and attenuates its epithelialmesenchymal transition process.
24330498 Scinderin expression does not correlate with prognosis in head and neck cancer.
24212916 These results suggest that SCIN plays an important role in the proliferation of prostate cancer cells and lentivirus-mediated inhibition of SCIN expression may be a potential therapeutic method for the treatment of prostate cancer
19666531 calcium binding to the N terminus of adseverin dominates the activation process to expose the F-actin binding site on A2

AA Sequence

MARELYHEEFARAGKQAGLQVWRIEKLELVPVPQSAHGDFYVGDAYLVLHTAKTSRGFTYHLHFWLGKEC      1 - 70
SQDESTAAAIFTVQMDDYLGGKPVQNRELQGYESNDFVSYFKGGLKYKAGGVASGLNHVLTNDLTAKRLL     71 - 140
HVKGRRVVRATEVPLSWDSFNKGDCFIIDLGTEIYQWCGSSCNKYERLKANQVATGIRYNERKGRSELIV    141 - 210
VEEGSEPSELIKVLGEKPELPDGGDDDDIIADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSE    211 - 280
ECFILDHGAAKQIFVWKGKDANPQERKAAMKTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDK    281 - 350
DQSDGFGKVYVTEKVAQIKQIPFDASKLHSSPQMAAQHNMVDDGSGKVEIWRVENNGRIQVDQNSYGEFY    351 - 420
GGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPVHLLSLFKDKP    421 - 490
LIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGYIWVGKGASQ    491 - 560
EEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNKTGRFVIEE    561 - 630
IPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEP    631 - 700
PTFTGWFLGWDSSKW                                                           701 - 715
//

Text Mined References (23)

PMID Year Title
26365202 2015 Calcium-controlled conformational choreography in the N-terminal half of adseverin.
25303873 2015 Lentivirus-mediated silencing of SCIN inhibits proliferation of human lung carcinoma cells.
25174406 2014 Suppression of scinderin modulates epithelial?mesenchymal transition markers in highly metastatic gastric cancer cell line SGC?7901.
24330498 2013 Expression of EPHRIN-A1, SCINDERIN and MHC class I molecules in head and neck cancers and relationship with the prognostic value of intratumoral CD8+ T cells.
24212916 2014 Suppression of SCIN inhibits human prostate cancer cell proliferation and induces G0/G1 phase arrest.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19666531 2009 The crystal structure of the C-terminus of adseverin reveals the actin-binding interface.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...