Property Summary

NCBI Gene PubMed Count 24
PubMed Score 89.78
PubTator Score 33.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 2.900 1.4e-03
astrocytoma 1.700 4.4e-06
Astrocytoma, Pilocytic 3.500 7.0e-10
Atopic dermatitis -1.600 4.8e-05
Breast cancer 3.400 2.2e-02
cystic fibrosis -1.700 6.7e-03
ependymoma 2.700 1.3e-07
glioblastoma 2.600 2.2e-05
group 3 medulloblastoma -1.500 4.4e-02
interstitial cystitis -3.100 7.0e-04
intraductal papillary-mucinous adenoma (... 3.400 7.9e-04
intraductal papillary-mucinous carcinoma... 2.400 2.2e-02
intraductal papillary-mucinous neoplasm ... 3.100 2.1e-02
lung carcinoma 2.100 1.8e-08
medulloblastoma, large-cell -2.400 2.5e-03
nasopharyngeal carcinoma -3.000 3.7e-11
ovarian cancer -2.600 4.2e-09
pancreatic cancer 1.700 9.9e-04
psoriasis -1.200 4.5e-23
ulcerative colitis -2.100 1.2e-05

Gene RIF (8)

AA Sequence

MARELYHEEFARAGKQAGLQVWRIEKLELVPVPQSAHGDFYVGDAYLVLHTAKTSRGFTYHLHFWLGKEC      1 - 70
SQDESTAAAIFTVQMDDYLGGKPVQNRELQGYESNDFVSYFKGGLKYKAGGVASGLNHVLTNDLTAKRLL     71 - 140
HVKGRRVVRATEVPLSWDSFNKGDCFIIDLGTEIYQWCGSSCNKYERLKANQVATGIRYNERKGRSELIV    141 - 210
VEEGSEPSELIKVLGEKPELPDGGDDDDIIADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSE    211 - 280
ECFILDHGAAKQIFVWKGKDANPQERKAAMKTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDK    281 - 350
DQSDGFGKVYVTEKVAQIKQIPFDASKLHSSPQMAAQHNMVDDGSGKVEIWRVENNGRIQVDQNSYGEFY    351 - 420
GGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPVHLLSLFKDKP    421 - 490
LIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGYIWVGKGASQ    491 - 560
EEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNKTGRFVIEE    561 - 630
IPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEP    631 - 700
PTFTGWFLGWDSSKW                                                           701 - 715
//

Text Mined References (26)

PMID Year Title