Property Summary

NCBI Gene PubMed Count 32
PubMed Score 35.33
PubTator Score 150.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group A ependymoma -2.600 0.000
oligodendroglioma -1.400 0.000
astrocytoma -1.500 0.000
glioblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -3.900 0.000
sonic hedgehog group medulloblastoma -2.500 0.006
primitive neuroectodermal tumor -3.400 0.000
adult high grade glioma -1.800 0.036
pilocytic astrocytoma -2.500 0.000
lung carcinoma 2.500 0.000
Pick disease -1.400 0.005

Synonym

Gene

PANTHER Protein Class (2)

Gene RIF (16)

PMID Text
24695318 in addition to kinase activity, plasma membrane localization via the C1 domain and basic amino acids at the C-terminus were indispensable for neurite induction by DGKbeta
23814057 forced expression of diacylglycerol kinase beta abrogated DAG accumulation at the phagosome, leading to impaired respiratory burst.
21493725 findings further suggest that DGL-alpha and -beta may regulate neurite outgrowth by engaging temporally and spatially distinct molecular pathways
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20490451 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20419449 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKYNPEGKQDILNQTIDFEGFKLFMKTF      1 - 70
LEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPALLSGGLRMNKGAITPPRTTSPANTCSPEVIHLKDIVC     71 - 140
YLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENIISQMMHVAEYLEWDVTELNPILHEMMEEIDYDH    141 - 210
DGTVSLEEWIQGGMTTIPLLVLLGLENNVKDDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKY    211 - 280
TVHERCVARAPPSCIKTYVKSKRNTDVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQITLHNKC    281 - 350
ASHLKPECDCGPLKDHILPPTTICPVVLQTLPTSGVSVPEERQSTVKKEKSGSQQPNKVIDKNKMQRANS    351 - 420
VTVDGQGLQVTPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFR    421 - 490
VLACGGDGTVGWVLDCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILKDIENSTEIMLD    491 - 560
RWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFS    561 - 630
ATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDA    631 - 700
KELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTI    701 - 770
KITHKNQAPMLMGPPPKTGLFCSLVKRTRNRSKE                                        771 - 804
//

Text Mined References (32)

PMID Year Title
25187374 2015 Genome-wide association meta-analysis identifies novel variants associated with fasting plasma glucose in East Asians.
24695318 2014 Both the C1 domain and a basic amino acid cluster at the C-terminus are important for the neurite and branch induction ability of DGK?.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23814057 2013 Diacylglycerol kinases terminate diacylglycerol signaling during the respiratory burst leading to heterogeneous phagosomal NADPH oxidase activation.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
22627129 2012 Biosynthesis of alkyl lysophosphatidic acid by diacylglycerol kinases.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22399527 2012 Genome-wide screen for metabolic syndrome susceptibility Loci reveals strong lipid gene contribution but no evidence for common genetic basis for clustering of metabolic syndrome traits.
21493725 2011 Diacylglycerol lipase-alpha and -beta control neurite outgrowth in neuro-2a cells through distinct molecular mechanisms.
More...