Property Summary

NCBI Gene PubMed Count 34
PubMed Score 33.79
PubTator Score 150.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.800 3.6e-02
astrocytoma -1.500 1.0e-12
Astrocytoma, Pilocytic -2.500 1.4e-04
atypical teratoid / rhabdoid tumor -3.900 5.5e-05
ependymoma -2.300 3.5e-02
glioblastoma -1.900 7.3e-04
lung carcinoma 2.500 1.1e-16
medulloblastoma -2.300 3.5e-02
oligodendroglioma -1.300 1.4e-02
Pick disease -1.400 5.3e-03
primitive neuroectodermal tumor -3.400 2.5e-04

Gene RIF (16)

AA Sequence

MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKYNPEGKQDILNQTIDFEGFKLFMKTF      1 - 70
LEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPALLSGGLRMNKGAITPPRTTSPANTCSPEVIHLKDIVC     71 - 140
YLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENIISQMMHVAEYLEWDVTELNPILHEMMEEIDYDH    141 - 210
DGTVSLEEWIQGGMTTIPLLVLLGLENNVKDDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKY    211 - 280
TVHERCVARAPPSCIKTYVKSKRNTDVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQITLHNKC    281 - 350
ASHLKPECDCGPLKDHILPPTTICPVVLQTLPTSGVSVPEERQSTVKKEKSGSQQPNKVIDKNKMQRANS    351 - 420
VTVDGQGLQVTPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFR    421 - 490
VLACGGDGTVGWVLDCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILKDIENSTEIMLD    491 - 560
RWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFS    561 - 630
ATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDA    631 - 700
KELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTI    701 - 770
KITHKNQAPMLMGPPPKTGLFCSLVKRTRNRSKE                                        771 - 804
//

Text Mined References (34)

PMID Year Title