Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.05
PubTator Score 0.07

Knowledge Summary

Patent (895)

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 8.3e-09
ependymoma -1.500 6.9e-10
glioblastoma -1.500 2.0e-04
osteosarcoma -1.320 4.0e-05
pediatric high grade glioma -1.300 3.3e-06

Gene RIF (1)

AA Sequence

MSLVACECLPSPGLEPEPCSRARSQAHVYLEQIRNRVALGVPDMTKRDYLVDAATQIRLALERDVSEDYE      1 - 70
AAFNHYQNGVDVLLRGIHVDPNKERREAVKLKITKYLRRAEEIFNCHLQRPLSSGASPSAGFSSLRLRPI     71 - 140
RTLSSAVEQLRGCRVVGVIEKVQLVQDPATGGTFVVKSLPRCHMVSRERLTIIPHGVPYMTKLLRYFVSE    141 - 210
DSIFLHLEHVQGGTLWSHLLSQAHSRHSGLSSGSTQERMKAQLNPHLNLLTPARLPSGHAPGQDRIALEP    211 - 280
PRTSPNLLLAGEAPSTRPQREAEGEPTARTSTSGSSDLPKAPGGHLHLQARRAGQNSDAGPPRGLTWVPE    281 - 350
GAGPVLGGCGRGMDQSCLSADGAGRGCGRATWSVREEQVKQWAAEMLVALEALHEQGVLCRDLHPGNLLL    351 - 420
DQAGHIRLTYFGQWSEVEPQCCGEAVDNLYSAPEVGGISELTEACDWWSFGSLLYELLTGMALSQSHPSG    421 - 490
IQAHTQLQLPEWLSRPAASLLTELLQFEPTRRLGMGEGGVSKLKSHPFFSTIQWSKLVG               491 - 549
//

Text Mined References (8)

PMID Year Title