Property Summary

NCBI Gene PubMed Count 33
PubMed Score 29.18
PubTator Score 49.36

Knowledge Summary

Patent (3,455)

TINX Plot

  Disease Sources (3)

Disease Target Count
Endometrial Neoplasms 50
Disease Target Count P-value
pituitary cancer 1972 2.58980815879813E-7
malignant mesothelioma 3163 8.69080851032196E-7
Amyotrophic Lateral Sclerosis 432 2.54832878795887E-6
ovarian cancer 8492 3.23334379972942E-6
tuberculosis 1563 3.13045212121822E-5
psoriasis 6685 1.24700110592377E-4
dermatomyositis 967 2.05327384183497E-4
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis 1.600 0.000
Amyotrophic Lateral Sclerosis 1.040 0.000
tuberculosis -1.200 0.000
ovarian cancer -1.400 0.000
pituitary cancer 1.900 0.000
dermatomyositis 1.300 0.000

Synonym

Accession Q9Y6R4 A6H8W0 B7ZLD3 B9EG75 Q5VTT8 Q5VTT9 Q92612 Q9H408
Symbols MTK1
MEKK4
MEKK 4
MAPKKK4
PRO0412

Gene

  Ortholog (12)

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
26802931 IL-21 expression is promoted by MEKK4 in malignant T cells and is associated with progression risk in cutaneous T-cell lymphoma
25173755 Mutations in genes such as AKT2, CCNA1, MAP3K4, and TGFBR1, were associated significantly with Epstein-Barr-positive gastric tumors, compared with EBV-negative tumors.
24452333 Map3k4 haploinsufficiency is the cause of T-associated sex reversal.
24036211 MTK1 was identified in the HER2/HER3-HRG mediated extracellular acidification and cell migration pathway in breast cancer cells.
23760366 MAP3K4 is sufficiently mediate the TGFbeta-induced phosphorylation of p38 MAPK in MEFs and HaCaT cells.
22732089 we have identified a reduced IL-1A response, related to a low MAP3K4 expression and high expression of its inhibitor GSK3beta, identifying a novel key player in Crohn's disease.
22309839 For the first time we report a significant association between nicotine dependence and DRD5, NPY1R MAP3K4 single nucleotide polymorphism.
21152872 The upstream molecule of the TRAIL-induced MAPK activation is MEKK, as opposed to ASK1, via the mediation of its signal through JNK/p38 in a caspase-8-dependent manner.
20624154 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20221403 CIN85 binding to a C-terminal motif within hTTP leads to the increased phosphorylation of hTTP, possibly through enhanced association with MEKK4
More...

AA Sequence

MREAAAALVPPPAFAVTPAAAMEEPPPPPPPPPPPPEPETESEPECCLAARQEGTLGDSACKSPESDLED      1 - 70
FSDETNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNAPNQPPHKDTGKTVENVEEYSY     71 - 140
KQEKKIRAALRTTERDRKKNVQCSFMLDSVGGSLPKKSIPDVDLNKPYLSLGCSNAKLPVSVPMPIARPA    141 - 210
RQTSRTDCPADRLKFFETLRLLLKLTSVSKKKDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQ    211 - 280
DFFLYTARQAIPDIINEILTFKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVS    281 - 350
FEQVKRIMELLEYIEALYPSLQALQKDYEKYAAKDFQDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLS    351 - 420
DIGWPVFEIPSPRPSKGNEPEYEGDDTEGELKELESSTDESEEEQISDPRVPEIRQPIDNSFDIQSRDCI    421 - 490
SKKLERLESEDDSLGWGAPDWSTEAGFSRHCLTSIYRPFVDKALKQMGLRKLILRLHKLMDGSLQRARIA    491 - 560
LVKNDRPVEFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEELKAMDLPSFEPAFLVLCRVLLNVIHEC    561 - 630
LKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEEDLHKMLMV    631 - 700
YFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGL    701 - 770
QESCAEFWTSADDSSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRD    771 - 840
LLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEKSIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRA    841 - 910
RDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQQSIEGLMTLCQEQTSSQ    911 - 980
PVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEV    981 - 1050
VRLMSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQA   1051 - 1120
LMNECIGHVIGKPHSPVTGLYLAIHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPA   1121 - 1190
AAAAAAAAAVAASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEP   1191 - 1260
AYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKSYDN   1261 - 1330
VMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHP   1331 - 1400
NLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIF   1401 - 1470
LTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVT   1471 - 1540
GKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLDHSFVKVCTDEE     1541 - 1608
//

Text Mined References (42)

PMID Year Title
26802931 2016 The Expression of IL-21 Is Promoted by MEKK4 in Malignant T Cells and Associated with Increased Progression Risk in Cutaneous T-Cell Lymphoma.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25173755 2014 Integrative identification of Epstein-Barr virus-associated mutations and epigenetic alterations in gastric cancer.
24452333 2014 Transgenic expression of Map3k4 rescues T-associated sex reversal (Tas) in mice.
24036211 2014 HER2/HER3 regulates extracellular acidification and cell migration through MTK1 (MEKK4).
23760366 2013 The TGF?-induced phosphorylation and activation of p38 mitogen-activated protein kinase is mediated by MAP3K4 and MAP3K10 but not TAK1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22773346 2013 Linkage and association of successful aging to the 6q25 region in large Amish kindreds.
22732089 2012 Defective IL-1A expression in patients with Crohn's disease is related to attenuated MAP3K4 signaling.
22309839 2012 Association study of 45 candidate genes in nicotine dependence in Han Chinese.
More...