Property Summary

NCBI Gene PubMed Count 33
PubMed Score 31.83
PubTator Score 49.36

Knowledge Summary

Patent (3,455)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Endometrial Neoplasms 55 0.0 0.0
Wilms Tumor 28 0.0 0.0
Disease Target Count P-value
pituitary cancer 1972 2.6e-07
malignant mesothelioma 3232 8.7e-07
Amyotrophic lateral sclerosis 451 2.5e-06
ovarian cancer 8520 3.2e-06
tuberculosis 2010 2.1e-05
psoriasis 6694 1.2e-04
dermatomyositis 966 2.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.9

Expression

  Differential Expression (7)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.040 2.5e-06
dermatomyositis 1.300 2.1e-04
malignant mesothelioma 1.400 8.7e-07
ovarian cancer -1.400 3.2e-06
pituitary cancer 1.900 2.6e-07
psoriasis 1.600 1.2e-04
tuberculosis -1.100 2.1e-05

Gene RIF (14)

AA Sequence

MREAAAALVPPPAFAVTPAAAMEEPPPPPPPPPPPPEPETESEPECCLAARQEGTLGDSACKSPESDLED      1 - 70
FSDETNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNAPNQPPHKDTGKTVENVEEYSY     71 - 140
KQEKKIRAALRTTERDRKKNVQCSFMLDSVGGSLPKKSIPDVDLNKPYLSLGCSNAKLPVSVPMPIARPA    141 - 210
RQTSRTDCPADRLKFFETLRLLLKLTSVSKKKDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQ    211 - 280
DFFLYTARQAIPDIINEILTFKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVS    281 - 350
FEQVKRIMELLEYIEALYPSLQALQKDYEKYAAKDFQDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLS    351 - 420
DIGWPVFEIPSPRPSKGNEPEYEGDDTEGELKELESSTDESEEEQISDPRVPEIRQPIDNSFDIQSRDCI    421 - 490
SKKLERLESEDDSLGWGAPDWSTEAGFSRHCLTSIYRPFVDKALKQMGLRKLILRLHKLMDGSLQRARIA    491 - 560
LVKNDRPVEFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEELKAMDLPSFEPAFLVLCRVLLNVIHEC    561 - 630
LKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEEDLHKMLMV    631 - 700
YFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGL    701 - 770
QESCAEFWTSADDSSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRD    771 - 840
LLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEKSIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRA    841 - 910
RDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQQSIEGLMTLCQEQTSSQ    911 - 980
PVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEV    981 - 1050
VRLMSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQA   1051 - 1120
LMNECIGHVIGKPHSPVTGLYLAIHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPA   1121 - 1190
AAAAAAAAAVAASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEP   1191 - 1260
AYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKSYDN   1261 - 1330
VMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHP   1331 - 1400
NLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIF   1401 - 1470
LTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVT   1471 - 1540
GKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLDHSFVKVCTDEE     1541 - 1608
//

Text Mined References (42)

PMID Year Title