Property Summary

NCBI Gene PubMed Count 33
Grant Count 42
R01 Count 29
Funding $1,525,614.04
PubMed Score 29.18
PubTator Score 49.36

Knowledge Summary

Patent (3,455)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis 1.600 0.000
Amyotrophic Lateral Sclerosis 1.040 0.000
tuberculosis -1.200 0.000
ovarian cancer -1.400 0.000
pituitary cancer 1.900 0.000
dermatomyositis 1.300 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
26802931 IL-21 expression is promoted by MEKK4 in malignant T cells and is associated with progression risk in cutaneous T-cell lymphoma
25173755 Mutations in genes such as AKT2, CCNA1, MAP3K4, and TGFBR1, were associated significantly with Epstein-Barr-positive gastric tumors, compared with EBV-negative tumors.
24452333 Map3k4 haploinsufficiency is the cause of T-associated sex reversal.
24036211 MTK1 was identified in the HER2/HER3-HRG mediated extracellular acidification and cell migration pathway in breast cancer cells.
23760366 MAP3K4 is sufficiently mediate the TGFbeta-induced phosphorylation of p38 MAPK in MEFs and HaCaT cells.
22732089 we have identified a reduced IL-1A response, related to a low MAP3K4 expression and high expression of its inhibitor GSK3beta, identifying a novel key player in Crohn's disease.
22309839 For the first time we report a significant association between nicotine dependence and DRD5, NPY1R MAP3K4 single nucleotide polymorphism.
21152872 The upstream molecule of the TRAIL-induced MAPK activation is MEKK, as opposed to ASK1, via the mediation of its signal through JNK/p38 in a caspase-8-dependent manner.
20624154 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20221403 CIN85 binding to a C-terminal motif within hTTP leads to the increased phosphorylation of hTTP, possibly through enhanced association with MEKK4
More...

AA Sequence

MREAAAALVPPPAFAVTPAAAMEEPPPPPPPPPPPPEPETESEPECCLAARQEGTLGDSACKSPESDLED      1 - 70
FSDETNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNAPNQPPHKDTGKTVENVEEYSY     71 - 140
KQEKKIRAALRTTERDRKKNVQCSFMLDSVGGSLPKKSIPDVDLNKPYLSLGCSNAKLPVSVPMPIARPA    141 - 210
RQTSRTDCPADRLKFFETLRLLLKLTSVSKKKDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQ    211 - 280
DFFLYTARQAIPDIINEILTFKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVS    281 - 350
FEQVKRIMELLEYIEALYPSLQALQKDYEKYAAKDFQDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLS    351 - 420
DIGWPVFEIPSPRPSKGNEPEYEGDDTEGELKELESSTDESEEEQISDPRVPEIRQPIDNSFDIQSRDCI    421 - 490
SKKLERLESEDDSLGWGAPDWSTEAGFSRHCLTSIYRPFVDKALKQMGLRKLILRLHKLMDGSLQRARIA    491 - 560
LVKNDRPVEFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEELKAMDLPSFEPAFLVLCRVLLNVIHEC    561 - 630
LKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEEDLHKMLMV    631 - 700
YFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGL    701 - 770
QESCAEFWTSADDSSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRD    771 - 840
LLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEKSIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRA    841 - 910
RDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQQSIEGLMTLCQEQTSSQ    911 - 980
PVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEV    981 - 1050
VRLMSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQA   1051 - 1120
LMNECIGHVIGKPHSPVTGLYLAIHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPA   1121 - 1190
AAAAAAAAAVAASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEP   1191 - 1260
AYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKSYDN   1261 - 1330
VMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHP   1331 - 1400
NLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIF   1401 - 1470
LTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVT   1471 - 1540
GKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLDHSFVKVCTDEE     1541 - 1608
//

Text Mined References (42)

PMID Year Title
26802931 2016 The Expression of IL-21 Is Promoted by MEKK4 in Malignant T Cells and Associated with Increased Progression Risk in Cutaneous T-Cell Lymphoma.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25173755 2014 Integrative identification of Epstein-Barr virus-associated mutations and epigenetic alterations in gastric cancer.
24452333 2014 Transgenic expression of Map3k4 rescues T-associated sex reversal (Tas) in mice.
24036211 2014 HER2/HER3 regulates extracellular acidification and cell migration through MTK1 (MEKK4).
23760366 2013 The TGF?-induced phosphorylation and activation of p38 mitogen-activated protein kinase is mediated by MAP3K4 and MAP3K10 but not TAK1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22773346 2013 Linkage and association of successful aging to the 6q25 region in large Amish kindreds.
22732089 2012 Defective IL-1A expression in patients with Crohn's disease is related to attenuated MAP3K4 signaling.
22309839 2012 Association study of 45 candidate genes in nicotine dependence in Han Chinese.
More...