Property Summary

NCBI Gene PubMed Count 82
PubMed Score 436.19
PubTator Score 139.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 1.7
Disease Target Count Z-score Confidence
Retinitis Pigmentosa 226 0.0 4.0
Disease Target Count
Renal tubular acidosis 24

Expression

  Differential Expression (33)

Disease log2 FC p
active Crohn's disease -1.011 3.9e-02
active ulcerative colitis -1.193 6.3e-03
Alzheimer's disease -1.800 4.4e-02
astrocytic glioma 2.900 4.5e-02
atypical teratoid / rhabdoid tumor -1.200 3.9e-03
colon cancer -3.100 2.8e-02
cystic fibrosis -1.082 1.2e-04
Down syndrome 1.100 9.4e-03
ductal carcinoma in situ -2.800 3.9e-04
ependymoma -1.300 1.5e-02
glioblastoma 1.200 1.1e-02
group 3 medulloblastoma -3.000 2.4e-05
interstitial cystitis -1.300 6.3e-03
intraductal papillary-mucinous adenoma (... -1.500 1.9e-03
intraductal papillary-mucinous carcinoma... -2.800 3.2e-02
intraductal papillary-mucinous neoplasm ... -2.100 1.9e-02
invasive ductal carcinoma -2.800 7.8e-03
lung adenocarcinoma -1.400 3.3e-08
lung cancer -1.100 3.0e-02
lung carcinoma -2.600 5.6e-24
malignant mesothelioma -6.800 1.4e-09
medulloblastoma, large-cell -1.600 6.0e-07
nephrosclerosis -2.096 2.7e-02
non-small cell lung cancer -2.132 1.8e-13
oligodendroglioma 1.500 1.3e-02
ovarian cancer -5.700 1.9e-22
pancreatic cancer -1.700 3.0e-03
Pick disease -2.100 1.2e-04
pituitary cancer -3.000 7.2e-06
primary pancreatic ductal adenocarcinoma -1.759 4.6e-02
primitive neuroectodermal tumor -2.500 1.6e-02
progressive supranuclear palsy -1.500 3.8e-02
tuberculosis 1.400 2.3e-04

Gene RIF (56)

AA Sequence

MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHKEKKEKERISENYSDKSDI      1 - 70
ENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQ     71 - 140
GGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPELKDKVTYTLLR    141 - 210
KHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPR    211 - 280
DAEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSD    281 - 350
EVFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTP    351 - 420
HDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGL    421 - 490
LGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDNNFDYLEFRLWIGLW    491 - 560
SAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSNFKVGYNTLFSCTCV    561 - 630
PPDPANISISNDTTLAPEYLPTMSSTDMYHNTTFDWAFLSKKECSKYGGNLVGNNCNFVPDITLMSFILF    631 - 700
LGTYTSSMALKKFKTSPYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFV    701 - 770
PPFGENPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVICSLMALPW    771 - 840
YVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFL    841 - 910
YMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMI    911 - 980
LALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMD    981 - 1050
IMEQQPFLSDSKPSDRERSPTFLERHTSC                                            1051 - 1079
//

Text Mined References (86)

PMID Year Title