Property Summary

NCBI Gene PubMed Count 23
PubMed Score 317.95
PubTator Score 19.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y6R0 Q7Z4J9
Symbols NBL
CAG3A
CTG3a
NUMBR
NUMB-R
TNRC23
NUMBLIKE

Gene

PANTHER Protein Class (1)

PDB

3F0W  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

MSRSAAASGGPRRPERHLPPAPCGAPGPPETCRTEPDGAGTMNKLRQSLRRRKPAYVPEASRPHQWQADE      1 - 70
DAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKSVLWVSADGLRVVDDKTKDLLVDQT     71 - 140
IEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAFAACLERKQRREKECGVTA    141 - 210
AFDASRTSFAREGSFRLSGGGRPAEREAPDKKKAEAAAAPTVAPGPAQPGHVSPTPATTSPGEKGEAGTP    211 - 280
VAAGTTAAAIPRRHAPLEQLVRQGSFRGFPALSQKNSPFKRQLSLRLNELPSTLQRRTDFQVKGTVPEME    281 - 350
PPGAGDSDSINALCTQISSSFASAGAPAPGPPPATTGTSAWGEPSVPPAAAFQPGHKRTPSEAERWLEEV    351 - 420
SQVAKAQQQQQQQQQQQQQQQQQQQQAASVAPVPTMPPALQPFPAPVGPFDAAPAQVAVFLPPPHMQPPF    421 - 490
VPAYPGLGYPPMPRVPVVGITPSQMVANAFCSAAQLQPQPATLLGKAGAFPPPAIPSAPGSQARPRPNGA    491 - 560
PWPPEPAPAPAPELDPFEAQWAALEGKATVEKPSNPFSGDLQKTFEIEL                         561 - 609
//

Text Mined References (26)

PMID Year Title