Property Summary

NCBI Gene PubMed Count 20
Grant Count 128
R01 Count 91
Funding $23,427,354.59
PubMed Score 306.09
PubTator Score 19.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y6R0 Q7Z4J9
Symbols NBL
CAG3A
CTG3a
NUMBR
NUMB-R
TNRC23
NUMBLIKE

Gene

PANTHER Protein Class (1)

PDB

3F0W  

Gene RIF (9)

PMID Text
26069237 Numb/Numbl control VEGF receptor endocytosis, signaling, and recycling in endothelial cells, which promotes the angiogenic growth of blood vessels.
23681800 Numbl might be involved in the inhibition of growth, proliferation, and invasion of 95-D lung cancer cells.
23440423 Numbl-Klf4 signaling is critical to maintain multiple nodes of metastatic progression, including persistence of cancer-initiating cells.
22593207 data suggest that Numbl regulates glioma cell migration and invasion by abrogating TRAF5-induced activation of NF-KappaB
20079715 NUMBL interacts with TRAF6 and promotes the degradation of TRAF6 in vivo, leading to the inhibition of NF-kappaB signaling pathway.
18940473 Both gene sequence alterations and amplifications of LNX1 and Numbl are present in a subset of human gliomas.
18940473 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of numb homolog (Drosophila)-like (NUMBL) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16899352 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRSAAASGGPRRPERHLPPAPCGAPGPPETCRTEPDGAGTMNKLRQSLRRRKPAYVPEASRPHQWQADE      1 - 70
DAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKSVLWVSADGLRVVDDKTKDLLVDQT     71 - 140
IEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAFAACLERKQRREKECGVTA    141 - 210
AFDASRTSFAREGSFRLSGGGRPAEREAPDKKKAEAAAAPTVAPGPAQPGHVSPTPATTSPGEKGEAGTP    211 - 280
VAAGTTAAAIPRRHAPLEQLVRQGSFRGFPALSQKNSPFKRQLSLRLNELPSTLQRRTDFQVKGTVPEME    281 - 350
PPGAGDSDSINALCTQISSSFASAGAPAPGPPPATTGTSAWGEPSVPPAAAFQPGHKRTPSEAERWLEEV    351 - 420
SQVAKAQQQQQQQQQQQQQQQQQQQQAASVAPVPTMPPALQPFPAPVGPFDAAPAQVAVFLPPPHMQPPF    421 - 490
VPAYPGLGYPPMPRVPVVGITPSQMVANAFCSAAQLQPQPATLLGKAGAFPPPAIPSAPGSQARPRPNGA    491 - 560
PWPPEPAPAPAPELDPFEAQWAALEGKATVEKPSNPFSGDLQKTFEIEL                         561 - 609
//

Publication (23)

PMID Year Title
26069237 2015 Regulation of vascular endothelial growth factor receptor function in angiogenesis by numb and numb-like.
23681800 2013 Numblike regulates proliferation, apoptosis, and invasion of lung cancer cell.
23440423 2013 Regulation of lung cancer metastasis by Klf4-Numb-like signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22593207 2012 Numbl inhibits glioma cell migration and invasion by suppressing TRAF5-mediated NF-?B activation.
22446962 2012 A genome-wide association study identifies three new risk loci for Kawasaki disease.
20079715 2010 NUMBL interacts with TRAF6 and promotes the degradation of TRAF6.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18940473 2008 Mutation and copy number analysis of LNX1 and Numbl in nervous system tumors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...