Property Summary

NCBI Gene PubMed Count 236
Grant Count 278
R01 Count 201
Funding $21,779,464.13
PubMed Score 456.95
PubTator Score 296.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.452 0.009
malignant mesothelioma -1.400 0.000
astrocytic glioma 1.300 0.005
ependymoma 1.200 0.016
oligodendroglioma 1.100 0.012
psoriasis 1.900 0.000
osteosarcoma -2.434 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.400 0.000
primitive neuroectodermal tumor 1.500 0.000
Crohn's disease -1.381 0.003
ulcerative colitis -1.600 0.010
intraductal papillary-mucinous neoplasm ... 1.800 0.015
lung cancer -1.300 0.000
non primary Sjogren syndrome sicca -1.200 0.013
spina bifida -1.171 0.043
Pick disease 1.600 0.000
ovarian cancer 1.900 0.000

Synonym

Accession Q9Y6Q9 A4LAZ5 Q0VF45 Q5JYD9 Q5JYE0 Q9BR49 Q9UPC9 Q9UPG4 Q9UPG7 NCoA-3
Symbols ACTR
AIB1
RAC3
SRC3
pCIP
AIB-1
CTG26
SRC-3
CAGH16
KAT13B
TNRC14
TNRC16
TRAM-1
bHLHe42

Gene

PDB

1KBH   3L3X   3L3Z  

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
731 screening 519 / 0 / 195737 Primary biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1048 other 390 / 0 / 98977 Measurement of TR-FRET detection format artefact in the screen for agonists of steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1301 screening 230 / 0 / 564 Confirmation biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1331 confirmatory 6 / 0 / 343 Dose response biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPARgamma)
1684 confirmatory 11 / 0 / 389 TR-FRET dose response biochemical High Throughput Screening assay for agonists of the steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPAR gamma): non-selective agonists
1812 summary 0 / 0 / 0 Summary of probe development efforts to identify agonists of the steroid receptor coactivator 3 (SRC-3) recruitment by the peroxisome proliferator-activated receptor gamma (PPAR gamma)
588352 screening 621 / 0 / 358863 Luminescence-based cell-based primary high throughput screening assay to identify inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3)
588357 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3)
588792 screening 864 / 0 / 1437 Luminescence-based cell-based high throughput confirmation assay for inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3)
602166 confirmatory 119 / 0 / 110 Luminescence-based cell-based high throughput dose response assay for inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3)
More...

Gene RIF (190)

PMID Text
26833126 The transcriptional coactivator SRC-3.
26449542 NCOA3 polymorphisms might influence the risk of dyslipidemia and serum lipid levels in Chinese Han population.
26369632 Total SRC3 is selectively found at enhancer regions.
26345978 The aim of this study was to investigate the expression of AIB1 in human esophageal squamous cell carcinoma and its correlation with Ki67 expression.
26267537 Data suggest that over-stimulating the steroid seceptor coactivators SRC-1, SRC-2, and SRC-3 oncogenic program can be an effective strategy to kill cancer cells.
26211391 NCOA3 is subject to a cis-acting expression quantitative trait locus in articular cartilage, which correlates with the osteoarthritis association signal and with the OA-associated allele of the SNP rs116855380, which is located 10.3 kb upstream of NCOA3.
26066330 miR-137 has a role in targeting p160 steroid receptor coactivators SRC1, SRC2, and SRC3 and inhibits cell proliferation
25970779 AIB1 promotes gastric cancer cell proliferation, survival and invasiveness through modulating major signaling pathways such as ErbB and Wnt/beta-catenin pathways. Findings suggest that AIB1 plays an important role in the pathogenesis of gastric cancer.
25859975 we describe a TR-FRET assay that monitors the interaction of the estrogen receptor (ER) alpha ligand binding domain (labeled with a terbium chelate via a streptavidin-biotin interaction) with a sequence of coactivator protein SRC3
25728767 ER-alpha, SRC-3, and p300 form an active protein complex on estrogen response element-DNA.
More...

AA Sequence

MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDIDNFNVKPDKCA      1 - 70
ILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQALDGFLFVVNRDGNIVFVSEN     71 - 140
VTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNGVSWTNETQRQKSHTFNCRMLMKTPHDILED    141 - 210
INASPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVARRITTGERTFPSNPESFITRHDLSGKVVNI    211 - 280
DTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSK    281 - 350
LFRNPVTNDRHGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLA    351 - 420
DPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNIMISPRNRGSP    421 - 490
KIASHQFSPVAGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNITQPS    491 - 560
KVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSD    561 - 630
DRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAK    631 - 700
ITAEATGKDTSSITSCGDGNVVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCT    701 - 770
SSTIPSSSQEKDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLK    771 - 840
SSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGSSMGGPNRNVT    841 - 910
VTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSIPTLPLRSNSIPGARPVLQQQQQ    911 - 980
MLQMRPGEIPMGMGANPYGQAAASNQLGSWPDGMLSMEQVSHGTQNRPLLRNSLDDLVGPPSNLEGQSDE    981 - 1050
RALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGP   1051 - 1120
PMQGGFHLQGQSPSFNSMMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQA   1121 - 1190
LELKMENPTAGGAAVMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQ   1191 - 1260
QQQQQQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPTMPQAPPQQFPYQPNYGMGQQPDPAFGRVSS   1261 - 1330
PPNAMMSSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAVYSMVHMNGSSG   1331 - 1400
HMGQMNMNPMPMSGMPMGPDQKYC                                                 1401 - 1424
//

Publication (251)

PMID Year Title
26833126 2016 HER2 Signaling Drives DNA Anabolism and Proliferation through SRC-3 Phosphorylation and E2F1-Regulated Genes.
26449542 2015 Association of NCOA3 polymorphisms with Dyslipidemia in the Chinese Han population.
26369632 2016 SRC3 Phosphorylation at Serine 543 Is a Positive Independent Prognostic Factor in ER-Positive Breast Cancer.
26345978 2015 Roles of the AIB1 protein in the proliferation and transformation of human esophageal squamous cell carcinoma.
26267537 2015 Characterization of a Steroid Receptor Coactivator Small Molecule Stimulator that Overstimulates Cancer Cells and Leads to Cell Stress and Death.
26211391 2015 Correlation of the osteoarthritis susceptibility variants that map to chromosome 20q13 with an expression quantitative trait locus operating on NCOA3 and with functional variation at the polymorphism rs116855380.
26066330 2015 miR-137 Targets p160 Steroid Receptor Coactivators SRC1, SRC2, and SRC3 and Inhibits Cell Proliferation.
25970779 2015 Frequent amplification of AIB1, a critical oncogene modulating major signaling pathways, is associated with poor survival in gastric cancer.
25859975 2015 Estrogen receptor alpha/co-activator interaction assay: TR-FRET.
25728767 2015 Structure of a biologically active estrogen receptor-coactivator complex on DNA.
More...