Property Summary

NCBI Gene PubMed Count 196
PubMed Score 1549.90
PubTator Score 172.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
Breast cancer 3099 1.73017228318726E-11
malignant mesothelioma 3163 3.72294403246438E-6
tuberculosis 1563 8.66582619480462E-6
cystic fibrosis 1670 1.52984664326387E-5
pituitary cancer 1972 2.90416722835934E-5
urothelial carcinoma 318 1.06790412856284E-4
colon cancer 1475 1.31850679072486E-4
posterior fossa group A ependymoma 1511 9.48842593992759E-4
atypical teratoid / rhabdoid tumor 4369 0.00734688284599307
sonic hedgehog group medulloblastoma 1482 0.00914149362296591
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0101127849985991
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.01783204048653
pancreatic cancer 2300 0.0184781232176586
active Crohn's disease 918 0.0241638375959501
non primary Sjogren syndrome sicca 840 0.0304565129505045
primitive neuroectodermal tumor 3031 0.039038842951098
oligodendroglioma 2849 0.0467998856079877
medulloblastoma, large-cell 6234 0.0472346900392604
Disease Target Count Z-score Confidence
Osteoporosis 259 5.578 2.8
Paget's disease of bone 28 5.282 2.6
Disease Target Count Z-score Confidence
Osteopetrosis 40 4.256 2.1

Expression

Synonym

Accession Q9Y6Q6 I4EC36 I4EC38 I4EC39 I7JE63 N0GVH0 Q59EP9
Symbols FEO
OFE
ODFR
OSTS
PDB2
RANK
CD265
OPTB7
TRANCER
LOH18CR1

Gene

PDB

1LB5  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (173)

PMID Text
26977008 Study showed that endogenous RANK expression changes might influence prostate cancer cell behavior since reduced RANK expression resulted in significantly increased PC-3 cell proliferation and adhesion.
26617755 expression of OPG, RANK and RANKL genes exert a crucial role in the progression of avascular necrosis
26528707 RANK/OPG ratio of expression in primary ccRCC is associated with BM.
26451891 Based on our findings, the functional SNP RANK rs1805034 T>C may be an indicator for individual susceptibility to GCA.
26398902 high level of mRANKL/RANK expression in cervical cancer lesions plays an important role in the rapid growth of cervical cancer cells possibly through strengthening the dialogue between cervical cancer cells and regulation of IL-8 secretion
26276390 results indicate that the RANK IVVY motif cooperates with the TRAF-binding motifs to promote osteoclastogenesis, which provides novel insights into the molecular mechanism of RANK signaling in osteoclastogenesis.
26200837 Src expression showed a significantly positive linear relationship with RANK, suggesting a potential mechanism of the RANKL-RANK axis in regulating breast cancer cell differentiation and antiapoptosis.
26087197 Results suggest that Cbl-b improves the prognosis of RANK-expressing breast cancer patients by inhibiting RANKL-induced breast cancer cell migration and metastasis.
25973136 this study is the first to identify RANK overexpression as a novel esophageal cancer marker in both Kazakh and Han ethnic esophageal squamous cell carcinoma patients.
25893522 Response to sRANKL in normal and tumor cells suggests a role for RANK/ERK-mediated signaling in normal osteoblasts chemotactic migration during bone remodeling that is altered or lost during osteosarcoma tumorigenesis.
More...

AA Sequence

MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLP      1 - 70
CGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQ     71 - 140
HPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVY    141 - 210
LPGLIILLLFASVALVAAIIFGVCYRKKGKALTANLWHWINEACGRLSGDKESSGDSCVSTHTANFGQQG    211 - 280
ACEGVLLLTLEEKTFPEDMCYPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYM    281 - 350
DRPSQPTDQLLFLTEPGSKSTPPFSEPLEVGENDSLSQCFTGTQSTVGSESCNCTEPLCRTDWTPMSSEN    351 - 420
YLQKEVDSGHCPHWAASPSPNWADVCTGCRNPPGEDCEPLVGSPKRGPLPQCAYGMGLPPEEEASRTEAR    421 - 490
DQPEDGADGRLPSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQEGAA    491 - 560
AAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLREPEKASRPVQEQGGAKA                  561 - 616
//

Text Mined References (198)

PMID Year Title
26977008 2016 Targeting of Receptor Activator of Nuclear Kappa B (RANK) in PC-3 Cells Increases Cell Proliferation and Matrix Adhesion In Vitro.
26617755 2015 Expression of osteoprotegerin, RNAK and RANKL genes in femoral head avascular necrosis and related signaling pathway.
26528707 2015 RANK/OPG ratio of expression in primary clear-cell renal cell carcinoma is associated with bone metastasis and prognosis in patients treated with anti-VEGFR-TKIs.
26451891 2015 RANK rs1805034 T>C Polymorphism Is Associated with Susceptibility to Gastric Cardia Adenocarcinoma in a Chinese Population.
26398902 2015 RANKL/RANK interaction promotes the growth of cervical cancer cells by strengthening the dialogue between cervical cancer cells and regulation of IL-8 secretion.
26276390 2015 The IVVY Motif and Tumor Necrosis Factor Receptor-associated Factor (TRAF) Sites in the Cytoplasmic Domain of the Receptor Activator of Nuclear Factor ?B (RANK) Cooperate to Induce Osteoclastogenesis.
26200837 2016 The RANK Pathway in Advanced Breast Cancer: Does Src Play a Role?
26087197 2015 The E3 ubiquitin ligase Cbl-b improves the prognosis of RANK positive breast cancer patients by inhibiting RANKL-induced cell migration and metastasis.
25973136 2015 RANK overexpression as a novel esophageal cancer marker: validated immunohistochemical analysis of two different ethnicities.
25893522 2015 Regulation of Osteoblast Migration Involving Receptor Activator of Nuclear Factor-kappa B (RANK) Signaling.
More...