Property Summary

NCBI Gene PubMed Count 30
PubMed Score 336.38
PubTator Score 145.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 7.57850498435449E-16
intraductal papillary-mucinous adenoma (IPMA) 2956 2.5030606223455E-5
osteosarcoma 7933 5.37651575919006E-5
interstitial cystitis 2299 8.22797570238009E-5
psoriasis 6685 4.65913963995438E-4
ductal carcinoma in situ 1745 6.73415560982554E-4
invasive ductal carcinoma 2950 7.0555411271847E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.42635840468391E-4
Disease Target Count Z-score Confidence
Pain agnosia 99 5.313 2.7

Expression

  Differential Expression (8)

Synonym

Accession Q9Y6Q5 B2RDV5 Q9BSI8
Symbols mu2
MU1B
MU-1B
HSMU1B
AP1-mu2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (10)

PMID Text
23705972 The highly conserved C-terminal dileucine motif (residues 851-856) in the cytosolic domain of HIV-1 gp41 interacts with clathrin-associated AP-1 adaptor complexes
23077317 The highly conserved C-terminal dileucine motif (residues 851-856) in the cytosolic domain of HIV-1 gp41 interacts with clathrin-associated AP-1 adaptor complexes
21762802 The highly conserved C-terminal dileucine motif (residues 851-856) in the cytosolic domain of HIV-1 gp41 interacts with clathrin-associated AP-1 adaptor complexes
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18356317 The mechanism of iron absorption from mineralized Soybean ferritin using Caco-2 cells via a mu2-dependent endocytosis mechanism is reported.
17261850 PIPKIgamma also interacts with the mu subunits of clathrin adaptor protein (AP) complexes
17145811 The AP1M2 gene was shown to effectively separate these two tumor(chromophobe renal cell carcinoma (RCC) and benign oncocytoma) groups by quantitative reverse transcription-PCR using fresh tissue samples, with similar trends seen on formalin-fixed tissues.
12134076 Results suggest that mu1B interacts with different classes of basolateral targeting signals in distinct ways.
11222723 The highly conserved C-terminal dileucine motif (residues 851-856) in the cytosolic domain of HIV-1 gp41 interacts with clathrin-associated AP-1 adaptor complexes
9882340 The highly conserved C-terminal dileucine motif (residues 851-856) in the cytosolic domain of HIV-1 gp41 interacts with clathrin-associated AP-1 adaptor complexes

AA Sequence

MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYLVAT      1 - 70
TSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSN     71 - 140
KLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPEL    141 - 210
RLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIE    211 - 280
SVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPG    281 - 350
GKEYLMRAHFGLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQL    351 - 420
RTS                                                                       421 - 423
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
18356317 2008 Caco-2 intestinal epithelial cells absorb soybean ferritin by mu2 (AP2)-dependent endocytosis.
17261850 2007 Type I gamma phosphatidylinositol phosphate kinase modulates adherens junction and E-cadherin trafficking via a direct interaction with mu 1B adaptin.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17145811 2006 Gene expression profiling separates chromophobe renal cell carcinoma from oncocytoma and identifies vesicular transport and cell junction proteins as differentially expressed genes.
16343431 2006 Luteolin, a flavonoid, inhibits AP-1 activation by basophils.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...