Property Summary

NCBI Gene PubMed Count 31
PubMed Score 341.54
PubTator Score 145.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ductal carcinoma in situ 1.800 6.7e-04
interstitial cystitis -1.500 2.3e-02
intraductal papillary-mucinous adenoma (... 1.300 2.5e-05
intraductal papillary-mucinous carcinoma... 1.100 7.4e-04
invasive ductal carcinoma 2.200 7.1e-04
lung carcinoma 1.200 7.6e-16
osteosarcoma 1.037 5.4e-05
psoriasis 1.200 4.7e-04

Protein-protein Interaction (10)

Gene RIF (11)

AA Sequence

MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYLVAT      1 - 70
TSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSN     71 - 140
KLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPEL    141 - 210
RLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIE    211 - 280
SVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPG    281 - 350
GKEYLMRAHFGLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQL    351 - 420
RTS                                                                       421 - 423
//

Text Mined References (32)

PMID Year Title