Property Summary

NCBI Gene PubMed Count 10
Grant Count 25
R01 Count 16
Funding $2,051,638.5
PubMed Score 21.21

Knowledge Summary


No data available


  Differential Expression (26)

AA Sequence

HVQQRACYNIQVEIEKKWIKIDGEDPDKIGDCITQ                                       701 - 735

Publication (13)

PMID Year Title
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
22885925 2012 Genome-wide association study identifies eight new risk loci for polycystic ovary syndrome.
21151128 2011 Genome-wide association study identifies susceptibility loci for polycystic ovary syndrome on chromosome 2p16.3, 2p21 and 9q33.3.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11454741 2001 Human stoned B interacts with AP-2 and synaptotagmin and facilitates clathrin-coated vesicle uncoating.
11381094 2001 Stonin 2: an adaptor-like protein that interacts with components of the endocytic machinery.