Property Summary

NCBI Gene PubMed Count 10
PubMed Score 21.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung adenocarcinoma 2714 2.35583447575976E-10
lung carcinoma 2844 9.12963247653112E-9
adrenocortical carcinoma 1427 4.0435385697593E-7
malignant mesothelioma 3163 7.45813826685006E-7
psoriasis 6685 1.01361200027583E-5
pilocytic astrocytoma 3086 3.41252864868074E-5
colon cancer 1475 4.04640145845584E-4
atypical teratoid / rhabdoid tumor 4369 4.74709307729625E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.44518417528045E-4
glioblastoma 5572 9.92428583743923E-4
astrocytic glioma 2241 0.00119252358980339
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00123154276800231
pediatric high grade glioma 2712 0.00187665937817749
osteosarcoma 7933 0.00193919084932251
ovarian cancer 8492 0.00306457871677879
ependymoma 2514 0.00326538351939348
cutaneous lupus erythematosus 1056 0.00389211783957846
lung cancer 4473 0.00405077625262157
oligodendroglioma 2849 0.00531366915610953
invasive ductal carcinoma 2950 0.00789058682813034
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0116090593970996
primitive neuroectodermal tumor 3031 0.0140354142606262
acute myeloid leukemia 785 0.0169650773062388
urothelial carcinoma 318 0.0174938638022058
gastric carcinoma 832 0.0262752990295924
interstitial cystitis 2299 0.0273164559248843
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Polycystic Ovary Syndrome 335 0.0 2.0

Expression

  Differential Expression (26)

AA Sequence

MCSTNPGKWVTFDDDPAVQSSQKSKNFPLENQGVCRPNGLKLNLPGLREFPSGSSSTSSTPLSSPIVDFY      1 - 70
FSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYPIPESSSDSPLAISGGESSLLPTRPTCLSHALLPSDH     71 - 140
SCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDCAFSSPFWKDEGSDSHFTLDPPGSKKMFSSR    141 - 210
NKEMPIDQKSLNKCSLNYICEKLEHLQSAENQDSLRSLSMHCLCAEENASSFVPHTLFRSQPKSGWSFML    211 - 280
RIPEKKNMMSSRQWGPIFLKVLPGGILQMYYEQGLEKPFKEIQLDPYCRLSEPKVENFSVAGKIHTVKIE    281 - 350
HVSYTEKRKYHSKTEVVHEPDIEQMLKLGSTSYHDFLDFLTTVEEELMKLPAVSKPKKNYEEQEISLEIV    351 - 420
DNFWGKVTKEGKFVESAVITQIYCLCFVNGNLECFLTLNDLELPKRDESYYEKDSEKKGIDILDYHFHKC    421 - 490
VNVQEFEQSRIIKFVPLDACRFELMRFKTLYNGDNLPFSLKSVVVVQGAYVELQAFVNMASLAQRSSYAG    491 - 560
SLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSLQELESEPVIQVTVGSAKYESAYQA    561 - 630
VVWKIDRLPDKNSSLDHPHCLSYKLELGSDQEIPSDWYPFATVQFSVPDTCASRTEVRSLGVESDVQPQK    631 - 700
HVQQRACYNIQVEIEKKWIKIDGEDPDKIGDCITQ                                       701 - 735
//

Text Mined References (13)

PMID Year Title
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
22885925 2012 Genome-wide association study identifies eight new risk loci for polycystic ovary syndrome.
21151128 2011 Genome-wide association study identifies susceptibility loci for polycystic ovary syndrome on chromosome 2p16.3, 2p21 and 9q33.3.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11454741 2001 Human stoned B interacts with AP-2 and synaptotagmin and facilitates clathrin-coated vesicle uncoating.
11381094 2001 Stonin 2: an adaptor-like protein that interacts with components of the endocytic machinery.
More...