Property Summary

NCBI Gene PubMed Count 10
PubMed Score 21.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute myeloid leukemia -1.200 1.7e-02
adrenocortical carcinoma -1.709 4.0e-07
astrocytic glioma 3.400 1.2e-03
Astrocytoma, Pilocytic 2.400 2.9e-05
atypical teratoid / rhabdoid tumor 2.100 4.7e-04
colon cancer -2.600 4.0e-04
cutaneous lupus erythematosus -1.300 3.9e-03
ependymoma 3.800 3.3e-03
gastric carcinoma 1.600 2.6e-02
glioblastoma 1.600 8.4e-04
interstitial cystitis -1.100 2.7e-02
intraductal papillary-mucinous adenoma (... -2.100 1.2e-03
intraductal papillary-mucinous carcinoma... -2.100 9.4e-04
intraductal papillary-mucinous neoplasm ... -2.100 1.2e-02
invasive ductal carcinoma -1.500 7.9e-03
lung adenocarcinoma -1.300 2.4e-10
lung cancer -1.400 3.4e-03
lung carcinoma -1.400 9.1e-09
malignant mesothelioma -1.700 7.5e-07
oligodendroglioma 3.000 5.3e-03
osteosarcoma 1.588 1.9e-03
ovarian cancer -1.400 3.1e-03
pediatric high grade glioma 1.900 1.9e-03
primitive neuroectodermal tumor 2.200 1.4e-02
psoriasis -1.200 1.0e-05
urothelial carcinoma -2.500 1.7e-02

AA Sequence

MCSTNPGKWVTFDDDPAVQSSQKSKNFPLENQGVCRPNGLKLNLPGLREFPSGSSSTSSTPLSSPIVDFY      1 - 70
FSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYPIPESSSDSPLAISGGESSLLPTRPTCLSHALLPSDH     71 - 140
SCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDCAFSSPFWKDEGSDSHFTLDPPGSKKMFSSR    141 - 210
NKEMPIDQKSLNKCSLNYICEKLEHLQSAENQDSLRSLSMHCLCAEENASSFVPHTLFRSQPKSGWSFML    211 - 280
RIPEKKNMMSSRQWGPIFLKVLPGGILQMYYEQGLEKPFKEIQLDPYCRLSEPKVENFSVAGKIHTVKIE    281 - 350
HVSYTEKRKYHSKTEVVHEPDIEQMLKLGSTSYHDFLDFLTTVEEELMKLPAVSKPKKNYEEQEISLEIV    351 - 420
DNFWGKVTKEGKFVESAVITQIYCLCFVNGNLECFLTLNDLELPKRDESYYEKDSEKKGIDILDYHFHKC    421 - 490
VNVQEFEQSRIIKFVPLDACRFELMRFKTLYNGDNLPFSLKSVVVVQGAYVELQAFVNMASLAQRSSYAG    491 - 560
SLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSLQELESEPVIQVTVGSAKYESAYQA    561 - 630
VVWKIDRLPDKNSSLDHPHCLSYKLELGSDQEIPSDWYPFATVQFSVPDTCASRTEVRSLGVESDVQPQK    631 - 700
HVQQRACYNIQVEIEKKWIKIDGEDPDKIGDCITQ                                       701 - 735
//

Text Mined References (13)

PMID Year Title