Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.91
PubTator Score 8.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
breast carcinoma -1.800 9.8e-04
chronic kidney disease 1.600 9.9e-03
Duchenne muscular dystrophy 2.112 4.7e-11
Endometriosis -2.592 1.3e-02
inflammatory breast cancer -2.800 8.3e-03
invasive ductal carcinoma -3.304 4.8e-05
juvenile dermatomyositis 1.289 3.7e-08
malignant mesothelioma 2.300 1.1e-05
medulloblastoma, large-cell 1.300 1.1e-02
osteosarcoma 3.136 3.8e-02
psoriasis -1.100 1.7e-03

Synonym

Accession Q9Y6Q1 D3DUY7 Q9UEQ1 Q9UJA8
Symbols CANPX
CAPNX
CalpM
DJ914P14.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MGPPLKLFKNQKYQELKQECIKDSRLFCDPTFLPENDSLFYNRLLPGKVVWKRPQDICDDPHLIVGNISN      1 - 70
HQLTQGRLGHKPMVSAFSCLAVQESHWTKTIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLL     71 - 140
PTINGDLVFSFSTSMNEFWNALLEKAYAKLLGCYEALDGLTITDIIVDFTGTLAETVDMQKGRYTELVEE    141 - 210
KYKLFGELYKTFTKGGLICCSIESPNQEEQEVETDWGLLKGHTYTMTDIRKIRLGERLVEVFSAEKVYMV    211 - 280
RLRNPLGRQEWSGPWSEISEEWQQLTASDRKNLGLVMSDDGEFWMSLEDFCRNFHKLNVCRNVNNPIFGR    281 - 350
KELESVLGCWTVDDDPLMNRSGGCYNNRDTFLQNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGRPDNYI    351 - 420
IGFELFKVEMNRKFRLHHLYIQERAGTSTYIDTRTVFLSKYLKKGNYVLVPTMFQHGRTSEFLLRIFSEV    421 - 490
PVQLRELTLDMPKMSCWNLARGYPKVVTQITVHSAEDLEKKYANETVNPYLVIKCGKEEVRSPVQKNTVH    491 - 560
AIFDTQAIFYRRTTDIPIIVQVWNSRKFCDQFLGQVTLDADPSDCRDLKSLYLRKKGGPTAKVKQGHISF    561 - 630
KVISSDDLTEL                                                               631 - 641
//

Text Mined References (18)

PMID Year Title