Property Summary

NCBI Gene PubMed Count 17
Grant Count 25
R01 Count 21
Funding $3,721,124.14
PubMed Score 76.06
PubTator Score 21.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia -2.942 0.000
malignant mesothelioma -1.700 0.000
glioblastoma -1.400 0.004
medulloblastoma -1.300 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -2.000 0.000
non-small cell lung cancer -1.356 0.000
intraductal papillary-mucinous neoplasm ... -1.900 0.004
colon cancer 1.800 0.044
lung cancer -1.200 0.001
lung adenocarcinoma -1.700 0.000
pediatric high grade glioma -1.300 0.001
psoriasis -1.300 0.000
invasive ductal carcinoma -1.200 0.006
ovarian cancer -1.600 0.000

Gene RIF (4)

PMID Text
24587596 Rapamycin may prohibit sestrin1 downregulation through targeting mTORC2 in appeasing low shear stress induced EC oxidative apoptosis
20800603 Observational study of gene-disease association. (HuGE Navigator)
15105503 results show that sestrins, a family of proteins whose expression is modulated by p53, are required for regeneration of peroxiredoxins containing Cys-SO(2)H
12607115 PA26 mutations are an infrequent cause of heterotaxia (situs inversus) in humans.

AA Sequence

MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDEELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHAL      1 - 70
FADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCSYLVNLHVND     71 - 140
FLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAELVHAVVLLTHYH    141 - 210
SLASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKM    211 - 280
RQLQECRDEEEASQEEMASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFR    281 - 350
VQDYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDY    351 - 420
DYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAELLYALRAITRY    421 - 490
MT                                                                        491 - 492
//

Publication (23)

PMID Year Title
26449471 2016 Sestrin2 is a leucine sensor for the mTORC1 pathway.
25263562 2014 The Sestrins interact with GATOR2 to negatively regulate the amino-acid-sensing pathway upstream of mTORC1.
25259925 2014 Sestrins function as guanine nucleotide dissociation inhibitors for Rag GTPases to control mTORC1 signaling.
24587596 2014 Rapamycin attenuates endothelial apoptosis induced by low shear stress via mTOR and sestrin1 related redox regulation.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23274085 2013 Sestrins activate Nrf2 by promoting p62-dependent autophagic degradation of Keap1 and prevent oxidative liver damage.
21067298 2011 Gene expression following ionising radiation: identification of biomarkers for dose estimation and prediction of individual response.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19704005 2009 Regulation of protein synthesis by ionizing radiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...