Property Summary

NCBI Gene PubMed Count 19
PubMed Score 81.95
PubTator Score 21.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 6.2e-07
colon cancer 1.800 4.4e-02
glioblastoma -1.200 1.2e-04
group 4 medulloblastoma -1.200 4.9e-05
intraductal papillary-mucinous neoplasm ... -1.900 4.1e-03
invasive ductal carcinoma -1.200 5.8e-03
lung adenocarcinoma -1.600 2.4e-17
lung cancer -1.200 1.3e-03
malignant mesothelioma -1.700 5.8e-07
medulloblastoma, large-cell -2.000 2.0e-06
non-small cell lung cancer -1.356 5.8e-16
ovarian cancer -1.600 6.4e-10
pediatric high grade glioma -1.300 1.1e-03
psoriasis -1.300 5.0e-10
Waldenstrons macroglobulinemia -2.942 3.6e-06

Gene RIF (6)

AA Sequence

MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDEELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHAL      1 - 70
FADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCSYLVNLHVND     71 - 140
FLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAELVHAVVLLTHYH    141 - 210
SLASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKM    211 - 280
RQLQECRDEEEASQEEMASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFR    281 - 350
VQDYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDY    351 - 420
DYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAELLYALRAITRY    421 - 490
MT                                                                        491 - 492
//

Text Mined References (25)

PMID Year Title