Property Summary

NCBI Gene PubMed Count 58
PubMed Score 124.71
PubTator Score 63.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Usher syndrome 32 7.404 3.7
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 4.392 2.2
Disease Target Count Z-score Confidence
Sensorineural hearing loss 106 4.667 2.3
Blindness 88 4.568 2.3

Expression

  Differential Expression (11)

Disease log2 FC p
esophageal adenocarcinoma 1.200 2.0e-02
intraductal papillary-mucinous adenoma (... 1.300 4.2e-04
intraductal papillary-mucinous carcinoma... 1.400 2.1e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.8e-03
lung cancer 1.100 1.3e-02
lung carcinoma 2.900 1.4e-30
nephrosclerosis -1.123 4.0e-03
osteosarcoma 1.442 7.4e-03
pancreatic cancer 1.100 1.0e-04
pituitary cancer -1.100 1.3e-02
psoriasis -2.000 3.2e-10

Gene RIF (25)

AA Sequence

MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGDLKLVINEPSRLPLFDAIRPLIPLKH      1 - 70
QVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRGGLEFGCGLFISHLIKGGQADSVGLQVGDEIVRINGY     71 - 140
SISSCTHEEVINLIRTKKTVSIKVRHIGLIPVKSSPDEPLTWQYVDQFVSESGGVRGSLGSPGNRENKEK    141 - 210
KVFISLVGSRGLGCSISSGPIQKPGIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKS    211 - 280
SRSLTISIVAAAGRELFMTDRERLAEARQRELQRQELLMQKRLAMESNKILQEQQEMERQRRKEIAQKAA    281 - 350
EENERYRKEMEQIVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDG    351 - 420
GTEEQGEQDFRKYEEGFDPYSMFTPEQIMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAA    421 - 490
ERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDELTFF            491 - 552
//

Text Mined References (59)

PMID Year Title