Property Summary

NCBI Gene PubMed Count 19
Grant Count 5
R01 Count 2
Funding $294,274.33
PubMed Score 7.40
PubTator Score 5.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -6.200 0.000
glioblastoma -2.900 0.001
ependymoma -2.100 0.000
medulloblastoma -3.100 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -2.300 0.011
pediatric high grade glioma -1.900 0.004
subependymal giant cell astrocytoma -2.413 0.010
pituitary cancer 2.700 0.000
psoriasis -1.900 0.000

Gene RIF (4)

PMID Text
24898286 Unconventional CDH10, CDH24 and DCHS2 genes harbored frameshift mutations.
22846907 The CC genotype of rs4307059 located in the region between CDH9 and CDH10 is associated with completed suicide in a Polish cohort
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19404256 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MTIHQFLLLFLFWVCLPHFCSPEIMFRRTPVPQQRILSSRVPRSDGKILHRQKRGWMWNQFFLLEEYTGS      1 - 70
DYQYVGKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDREEKAFYTLRAQAINRRTLRPV     71 - 140
EPESEFVIKIHDINDNEPTFPEEIYTASVPEMSVVGTSVVQVTATDADDPSYGNSARVIYSILQGQPYFS    141 - 210
VEPETGIIRTALPNMNRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQNTIHLRVLE    211 - 280
SSPVGTAIGSVKATDADTGKNAEVEYRIIDGDGTDMFDIVTEKDTQEGIITVKKPLDYESRRLYTLKVEA    281 - 350
ENTHVDPRFYYLGPFKDTTIVKISIEDVDEPPVFSRSSYLFEVHEDIEVGTIIGTVMARDPDSISSPIRF    351 - 420
SLDRHTDLDRIFNIHSGNGSLYTSKPLDRELSQWHNLTVIAAEINNPKETTRVAVFVRILDVNDNAPQFA    421 - 490
VFYDTFVCENARPGQLIQTISAVDKDDPLGGQKFFFSLAAVNPNFTVQDNEDNTARILTRKNGFNRHEIS    491 - 560
TYLLPVVISDNDYPIQSSTGTLTIRVCACDSQGNMQSCSAEALLLPAGLSTGALIAILLCIIILLVIVVL    561 - 630
FAALKRQRKKEPLILSKEDIRDNIVSYNDEGGGEEDTQAFDIGTLRNPAAIEEKKLRRDIIPETLFIPRR    631 - 700
TPTAPDNTDVRDFINERLKEHDLDPTAPPYDSLATYAYEGNDSIAESLSSLESGTTEGDQNYDYLREWGP    701 - 770
RFNKLAEMYGGGESDKDS                                                        771 - 788
//

Text Mined References (22)

PMID Year Title
26503331 2015 Whole Exome Sequencing Identifies Frequent Somatic Mutations in Cell-Cell Adhesion Genes in Chinese Patients with Lung Squamous Cell Carcinoma.
25811964 2015 Derivatives containing both coumarin and benzimidazole potently induce caspase-dependent apoptosis of cancer cells through inhibition of PI3K-AKT-mTOR signaling.
24951259 2015 Novel recurrently mutated genes and a prognostic mutation signature in colorectal cancer.
24898286 2015 Frameshift mutations of cadherin genes DCHS2, CDH10 and CDH24 genes in gastric and colorectal cancers with high microsatellite instability.
24821223 2015 Genome-wide association study in obsessive-compulsive disorder: results from the OCGAS.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23279374 2013 Genetic determinants of plasma ??-glycoprotein I levels: a genome-wide association study in extended pedigrees from Spain.
22846907 2012 Analysis of four genes involved in the neurodevelopment shows association of rs4307059 polymorphism in the cadherin 9/10 region with completed suicide.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...