Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.34
PubTator Score 5.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -2.100 1.3e-05
glioblastoma -1.400 6.9e-03
group 3 medulloblastoma -2.200 4.2e-03
malignant mesothelioma -6.200 3.3e-10
medulloblastoma, large-cell -3.800 4.7e-05
pediatric high grade glioma -1.900 4.3e-03
pituitary cancer 2.700 4.8e-11
primitive neuroectodermal tumor -2.300 1.1e-02
psoriasis -1.900 8.8e-28
subependymal giant cell astrocytoma -2.413 9.5e-03

Gene RIF (5)

AA Sequence

MTIHQFLLLFLFWVCLPHFCSPEIMFRRTPVPQQRILSSRVPRSDGKILHRQKRGWMWNQFFLLEEYTGS      1 - 70
DYQYVGKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDREEKAFYTLRAQAINRRTLRPV     71 - 140
EPESEFVIKIHDINDNEPTFPEEIYTASVPEMSVVGTSVVQVTATDADDPSYGNSARVIYSILQGQPYFS    141 - 210
VEPETGIIRTALPNMNRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQNTIHLRVLE    211 - 280
SSPVGTAIGSVKATDADTGKNAEVEYRIIDGDGTDMFDIVTEKDTQEGIITVKKPLDYESRRLYTLKVEA    281 - 350
ENTHVDPRFYYLGPFKDTTIVKISIEDVDEPPVFSRSSYLFEVHEDIEVGTIIGTVMARDPDSISSPIRF    351 - 420
SLDRHTDLDRIFNIHSGNGSLYTSKPLDRELSQWHNLTVIAAEINNPKETTRVAVFVRILDVNDNAPQFA    421 - 490
VFYDTFVCENARPGQLIQTISAVDKDDPLGGQKFFFSLAAVNPNFTVQDNEDNTARILTRKNGFNRHEIS    491 - 560
TYLLPVVISDNDYPIQSSTGTLTIRVCACDSQGNMQSCSAEALLLPAGLSTGALIAILLCIIILLVIVVL    561 - 630
FAALKRQRKKEPLILSKEDIRDNIVSYNDEGGGEEDTQAFDIGTLRNPAAIEEKKLRRDIIPETLFIPRR    631 - 700
TPTAPDNTDVRDFINERLKEHDLDPTAPPYDSLATYAYEGNDSIAESLSSLESGTTEGDQNYDYLREWGP    701 - 770
RFNKLAEMYGGGESDKDS                                                        771 - 788
//

Text Mined References (23)

PMID Year Title