Property Summary

NCBI Gene PubMed Count 87
Grant Count 74
R01 Count 54
Funding $7,360,140.05
PubMed Score 114.03
PubTator Score 113.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
osteosarcoma 1.299 0.032
posterior fossa group B ependymoma -2.100 0.000
cystic fibrosis 3.108 0.000
primary pancreatic ductal adenocarcinoma 1.282 0.017
colon cancer 2.100 0.032
lung cancer 4.800 0.000
active Crohn's disease 2.638 0.012
sarcoidosis 1.200 0.008
Breast cancer 3.100 0.042
group 4 medulloblastoma -3.700 0.000
pilocytic astrocytoma 1.600 0.000
nasopharyngeal carcinoma 1.200 0.007
lung carcinoma 1.300 0.000
gastric carcinoma 1.800 0.016
ulcerative colitis 3.200 0.000
ovarian cancer -2.400 0.000
pancreatic cancer 1.300 0.014

Synonym

Accession Q9Y6N7 B2RXI1 D3DU36 E9PD49 Q1RMC7 Q7Z300 Q9BUS7
Symbols SAX3
DUTT1

Gene

PDB

2EO9   2V9Q   2V9R   2V9T   3WIH   4HLJ  

Gene RIF (66)

PMID Text
26975850 A SLIT2/ROBO1 signaling circuit as a key regulatory mechanism.
26713366 These results suggest that Slit2/Robo1 binding exerts an effect on cell migration, which is negatively regulated by Robo4, and Robo1 may function by interacting with CdGAP in HUVECs.
26608094 ROBO1 somatic mutation is associated with myelodysplastic syndrome progression. Overexpression of ROBO1 produces anti-proliferative and pro-apoptotic effects in leukaemia cells. However, this effect was lost in ROBO mutants.
26400100 our findings indicated that Slit2/Robo1 axis possibly be regarded as a significant clinical parameter for predicting brain metastasis in breast cancer patients.
26282852 expression pattern in extravillous trophoblasts associated with the remodeling events of the tubal pregnancy
26264936 Significantly increased serum Slit2 levels and hepatic expression of Slit2 and Robo1 were observed in patients with liver fibrosis.
26252416 miR-29a markedly inhibits the protein expression of Robo1 in mesenchymal stem cells.
26081620 these studies demonstrate that miR-219-5p inhibited cancer cell growth and invasion by direct targeting ROBO1, implicating miR-219-5p as an attractive candidate for cancer therapy.
26022159 Robo1 promoted cell division cycle 42 (Cdc42) expression in HUVECs, and a distorted actin cytoskeleton in HUVECs was observed when Robo1 expression was suppressed. In conclusion, Robo1 promoted angiogenesis in HCC mediated by Cdc42.
25955714 miR29a inhibits cell migration and invasion in breast cancer cells, at least in part, by directly targeting Robo1.
More...

AA Sequence

MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYTGSRLRQEDFPPRI      1 - 70
VEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRKSRP     71 - 140
DEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSP    141 - 210
LDDKDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAE    211 - 280
FKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEP    281 - 350
PHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQR    351 - 420
SDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRK    421 - 490
DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLI    491 - 560
PSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENVKTETSAIKGLKPNAIY    561 - 630
LFLVRAANAYGISDPSQISDPVKTQDVLPTSQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQ    631 - 700
SQYIQGYKILYRPSGANHGESDWLVFEVRTPAKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKT    701 - 770
LEEAPSAPPQGVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVWCLGNETRYHINKTVDGSTFSVVIP    771 - 840
FLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGNPVSPEDQVSLAQQISDVVKQPAFIAGIGAACWII    841 - 910
LMVFSIWLYRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGGRPGLLNISEPAAQPWLADTW    911 - 980
PNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEM    981 - 1050
KTFNSPNLKDGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIVEQN   1051 - 1120
KLNKDYRANDTVPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGGMNWADLLPPPP   1121 - 1190
AHPPPHSNSEEYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGPTPPVRGAASSPAAVSYSHQST   1191 - 1260
ATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSPPPPPRPISPPHTYGYISGPLVSDMDTDAPEEE   1261 - 1330
EDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWGSASEEDNISSGRSSVSSSDGSFFTD   1331 - 1400
ADFAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAAVMQKTRPAKKLKHQPGH   1401 - 1470
LRRETYTDDLPPPPVPPPAIKSPTAQSKTQLEVRPVVVPKLPSMDARTDRSSDRKGSSYKGREVLDGRQV   1471 - 1540
VDMRTNPGDPREAQEQQNDGKGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPRDPSSSSSMSSR   1541 - 1610
GSGSRQREQANVGRRNIAEMQVLGGYERGEDNNEELEETES                                1611 - 1651
//

Text Mined References (96)

PMID Year Title
26975850 2016 Loss of miR-203 regulates cell shape and matrix adhesion through ROBO1/Rac/FAK in response to stiffness.
26713366 2016 Suppression of Slit2/Robo1 mediated HUVEC migration by Robo4.
26608094 2015 Whole-exome and targeted sequencing identify ROBO1 and ROBO2 mutations as progression-related drivers in myelodysplastic syndromes.
26529257 2015 Myo9b is a key player in SLIT/ROBO-mediated lung tumor suppression.
26400100 2015 Low Expression of Slit2 and Robo1 is Associated with Poor Prognosis and Brain-specific Metastasis of Breast Cancer Patients.
26282852 2015 Role of Slit2/Robo1 in trophoblast invasion and vascular remodeling during ectopic tubal pregnancy.
26264936 2015 Activation of Slit2-Robo1 signaling promotes liver fibrosis.
26252416 2015 MicroRNA-29a inhibits mesenchymal stem cell viability and proliferation by targeting Roundabout 1.
26081620 2015 MicroRNA-219-5p exerts tumor suppressor function by targeting ROBO1 in glioblastoma.
26022159 2015 Robo1 promotes angiogenesis in hepatocellular carcinoma through the Rho family of guanosine triphosphatases' signaling pathway.
More...