Property Summary

NCBI Gene PubMed Count 101
PubMed Score 129.79
PubTator Score 113.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 2.638 1.2e-02
Astrocytoma, Pilocytic 1.600 4.0e-07
Breast cancer 3.100 4.2e-02
colon cancer 2.100 3.2e-02
cystic fibrosis 3.108 8.8e-07
ependymoma -1.500 3.6e-03
gastric carcinoma 1.800 1.6e-02
group 4 medulloblastoma -3.700 2.5e-09
lung cancer 4.800 7.0e-06
lung carcinoma 1.300 1.4e-12
malignant mesothelioma -1.700 1.1e-07
nasopharyngeal carcinoma 1.200 6.9e-03
osteosarcoma 1.299 3.2e-02
ovarian cancer -2.400 1.7e-05
pancreatic cancer 1.300 1.4e-02
primary pancreatic ductal adenocarcinoma 1.282 1.7e-02
sarcoidosis 1.200 8.4e-03
ulcerative colitis 3.200 1.8e-07

Protein-protein Interaction (4)

Gene RIF (78)

AA Sequence

MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYTGSRLRQEDFPPRI      1 - 70
VEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRKSRP     71 - 140
DEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSP    141 - 210
LDDKDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAE    211 - 280
FKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEP    281 - 350
PHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQR    351 - 420
SDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRK    421 - 490
DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLI    491 - 560
PSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENVKTETSAIKGLKPNAIY    561 - 630
LFLVRAANAYGISDPSQISDPVKTQDVLPTSQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQ    631 - 700
SQYIQGYKILYRPSGANHGESDWLVFEVRTPAKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKT    701 - 770
LEEAPSAPPQGVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVWCLGNETRYHINKTVDGSTFSVVIP    771 - 840
FLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGNPVSPEDQVSLAQQISDVVKQPAFIAGIGAACWII    841 - 910
LMVFSIWLYRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGGRPGLLNISEPAAQPWLADTW    911 - 980
PNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEM    981 - 1050
KTFNSPNLKDGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIVEQN   1051 - 1120
KLNKDYRANDTVPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGGMNWADLLPPPP   1121 - 1190
AHPPPHSNSEEYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGPTPPVRGAASSPAAVSYSHQST   1191 - 1260
ATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSPPPPPRPISPPHTYGYISGPLVSDMDTDAPEEE   1261 - 1330
EDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWGSASEEDNISSGRSSVSSSDGSFFTD   1331 - 1400
ADFAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAAVMQKTRPAKKLKHQPGH   1401 - 1470
LRRETYTDDLPPPPVPPPAIKSPTAQSKTQLEVRPVVVPKLPSMDARTDRSSDRKGSSYKGREVLDGRQV   1471 - 1540
VDMRTNPGDPREAQEQQNDGKGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPRDPSSSSSMSSR   1541 - 1610
GSGSRQREQANVGRRNIAEMQVLGGYERGEDNNEELEETES                                1611 - 1651
//

Text Mined References (110)

PMID Year Title