Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.87
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 1.365 8.4e-04
malignant mesothelioma -4.800 2.3e-09
psoriasis 1.200 1.9e-04
glioblastoma 2.300 1.6e-04
osteosarcoma -1.904 1.5e-03
medulloblastoma, large-cell -1.600 3.5e-05
adrenocortical carcinoma -1.383 4.9e-03
colon cancer -3.100 1.1e-02
lung cancer -2.500 3.1e-04
pediatric high grade glioma 1.100 9.0e-03
group 4 medulloblastoma -1.100 6.5e-05
pilocytic astrocytoma 1.600 2.4e-08
subependymal giant cell astrocytoma 1.955 3.1e-02
ovarian cancer -2.400 4.2e-05
pituitary cancer -2.300 2.0e-06

Gene RIF (5)

PMID Text
26258864 The I264T SQRDL polymorphism is associaated with osteoporosis in Korean postmenopausal women.
25225291 SQR is part of the human mitochondrial hydrogen sulfide oxidation pathway
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of sulfide quinone reductase-like (SQRDL) expression by HIV-1 Vpr in Vpr transduced macrophages
22852582 Sulfide:quinone oxidoreductase catalyzes the first step in hydrogen sulfide metabolism and produces a sulfane sulfur metabolite.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAARMKRKVGAEN      1 - 70
VAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRY     71 - 140
LIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMY    141 - 210
LSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDK    211 - 280
PGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVA    281 - 350
AQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKAD    351 - 420
LMPFLYWNMMLRGYWGGPAFLRKLFHLGMS                                            421 - 450
//

Text Mined References (20)

PMID Year Title
26258864 2015 Association of the I264T variant in the sulfide quinone reductase-like (SQRDL) gene with osteoporosis in Korean postmenopausal women.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25225291 2014 Organization of the human mitochondrial hydrogen sulfide oxidation pathway.
24954085 2014 Novel genetic variants modify the effect of smoking on carotid plaque burden in Hispanics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22852582 2012 Human sulfide:quinone oxidoreductase catalyzes the first step in hydrogen sulfide metabolism and produces a sulfane sulfur metabolite.
21410200 2011 Proteomics reveals that redox regulation is disrupted in patients with ethylmalonic encephalopathy.
21269460 2011 Initial characterization of the human central proteome.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20398623 2010 Oxidation of hydrogen sulfide remains a priority in mammalian cells and causes reverse electron transfer in colonocytes.
18494801 2008 Three enzymatic activities catalyze the oxidation of sulfide to thiosulfate in mammalian and invertebrate mitochondria.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
10224084 1999 A fission yeast gene for mitochondrial sulfide oxidation.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.