Property Summary

NCBI Gene PubMed Count 17
Grant Count 3
R01 Count 3
Funding $290,916.99
PubMed Score 12.87
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 1.365 0.001
malignant mesothelioma -4.800 0.000
psoriasis 1.200 0.000
glioblastoma 2.300 0.000
osteosarcoma -1.904 0.001
medulloblastoma, large-cell -1.600 0.000
adrenocortical carcinoma -1.383 0.005
colon cancer -3.100 0.011
lung cancer -2.500 0.000
pediatric high grade glioma 1.100 0.009
group 4 medulloblastoma -1.100 0.000
pilocytic astrocytoma 1.600 0.000
subependymal giant cell astrocytoma 1.955 0.031
ovarian cancer -2.400 0.000
pituitary cancer -2.300 0.000

Synonym

Accession Q9Y6N5 Q9UQM8 SQOR
Symbols SQOR
CGI-44
PRO1975

Gene

Gene RIF (5)

PMID Text
26258864 The I264T SQRDL polymorphism is associaated with osteoporosis in Korean postmenopausal women.
25225291 SQR is part of the human mitochondrial hydrogen sulfide oxidation pathway
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of sulfide quinone reductase-like (SQRDL) expression by HIV-1 Vpr in Vpr transduced macrophages
22852582 Sulfide:quinone oxidoreductase catalyzes the first step in hydrogen sulfide metabolism and produces a sulfane sulfur metabolite.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAARMKRKVGAEN      1 - 70
VAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRY     71 - 140
LIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMY    141 - 210
LSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDK    211 - 280
PGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVA    281 - 350
AQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKAD    351 - 420
LMPFLYWNMMLRGYWGGPAFLRKLFHLGMS                                            421 - 450
//

Text Mined References (20)

PMID Year Title
26258864 2015 Association of the I264T variant in the sulfide quinone reductase-like (SQRDL) gene with osteoporosis in Korean postmenopausal women.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25225291 2014 Organization of the human mitochondrial hydrogen sulfide oxidation pathway.
24954085 2014 Novel genetic variants modify the effect of smoking on carotid plaque burden in Hispanics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22852582 2012 Human sulfide:quinone oxidoreductase catalyzes the first step in hydrogen sulfide metabolism and produces a sulfane sulfur metabolite.
21410200 2011 Proteomics reveals that redox regulation is disrupted in patients with ethylmalonic encephalopathy.
21269460 2011 Initial characterization of the human central proteome.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
More...