Property Summary

NCBI Gene PubMed Count 19
PubMed Score 14.56
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.383 4.9e-03
Astrocytoma, Pilocytic 1.700 1.5e-08
colon cancer -3.100 1.1e-02
glioblastoma 2.300 1.6e-04
group 4 medulloblastoma -1.100 6.5e-05
lung cancer -2.500 3.1e-04
malignant mesothelioma -4.800 2.3e-09
medulloblastoma, large-cell -1.600 3.5e-05
Multiple myeloma 1.365 8.4e-04
osteosarcoma -1.904 1.5e-03
ovarian cancer -2.400 4.2e-05
pediatric high grade glioma 1.100 9.0e-03
pituitary cancer -2.300 2.0e-06
psoriasis 1.200 1.9e-04
subependymal giant cell astrocytoma 1.955 3.1e-02

Gene RIF (7)

AA Sequence

MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAARMKRKVGAEN      1 - 70
VAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRY     71 - 140
LIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMY    141 - 210
LSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDK    211 - 280
PGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVA    281 - 350
AQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKAD    351 - 420
LMPFLYWNMMLRGYWGGPAFLRKLFHLGMS                                            421 - 450
//

Text Mined References (22)

PMID Year Title