Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,683

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 5.100 0.000

AA Sequence

MVFSLKVILFLSLLLSPVLKSSLVTLNNNGYDGIVIAINPSVPEDEKLIQNIKEMVTEASTHLFHATKQR      1 - 70
AYFRNVSILIPMTYKSKSEYLIPKQETYDQADVIVADLYLKYGDDPYTLQYGQCGDKGQYIHFTPNFLLT     71 - 140
NNLATYGPRGKVFVHGWAHLRWGVFDEYNVDQPFYISRRNTTEATRCSTRITVYMVLNECKGASCIARPF    141 - 210
RRDSQTGLYEAKCTFIPKRSQTAKESIVFMQNLDSVTEFCTEKTHNKEAPNL                      211 - 262
//

Publication (4)

PMID Year Title
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11071307 2000 Molecular characteristics and functional diversity of CLCA family members.
10584316 1999 Clustering of the human CLCA gene family on the short arm of chromosome 1 (1p22-31).
10095065 1999 Molecular cloning and biochemical characterization of a truncated, secreted member of the human family of Ca2+-activated Cl- channels.