Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.5e-71

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 5.100 3.5e-71

AA Sequence

MVFSLKVILFLSLLLSPVLKSSLVTLNNNGYDGIVIAINPSVPEDEKLIQNIKEMVTEASTHLFHATKQR      1 - 70
AYFRNVSILIPMTYKSKSEYLIPKQETYDQADVIVADLYLKYGDDPYTLQYGQCGDKGQYIHFTPNFLLT     71 - 140
NNLATYGPRGKVFVHGWAHLRWGVFDEYNVDQPFYISRRNTTEATRCSTRITVYMVLNECKGASCIARPF    141 - 210
RRDSQTGLYEAKCTFIPKRSQTAKESIVFMQNLDSVTEFCTEKTHNKEAPNL                      211 - 262
//

Text Mined References (4)

PMID Year Title