Property Summary

NCBI Gene PubMed Count 14
Grant Count 14
R01 Count 10
Funding $1,370,928.01
PubMed Score 24.34
PubTator Score 9.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.683 0.001
astrocytic glioma -1.400 0.023
ependymoma -1.500 0.033
oligodendroglioma -1.200 0.047
psoriasis 1.400 0.000
osteosarcoma 1.966 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.500 0.001
medulloblastoma -1.400 0.001
medulloblastoma, large-cell -1.500 0.002
primitive neuroectodermal tumor -1.300 0.001
pancreatic ductal adenocarcinoma liver m... -1.101 0.026
lung cancer 1.500 0.003
Parkinson's disease -1.100 0.009
adult high grade glioma -1.100 0.023
ovarian cancer -1.600 0.000

Gene RIF (4)

PMID Text
22863968 meta-analysis suggested that polymorphism STXBP4/COX11 rs6504950 variant was significantly associated with breast cancer risk; the A allele of rs6504950 decreased the risk of breast cancer
20877624 Observational study of gene-disease association. (HuGE Navigator)
20601676 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19330027 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQP      1 - 70
PRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIE     71 - 140
NMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQ    141 - 210
YFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN        211 - 276
//

Publication (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
22863968 2012 Association of STXBP4/COX11 rs6504950 (G>A) polymorphism with breast cancer risk: evidence from 17,960 cases and 22,713 controls.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20601676 2010 Analysis of SNPs with an effect on gene expression identifies UBE2L3 and BCL3 as potential new risk genes for Crohn's disease.
19330027 2009 Newly discovered breast cancer susceptibility loci on 3p24 and 17q23.2.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15840172 2005 Physical interaction and functional coupling between ACDP4 and the intracellular ion chaperone COX11, an implication of the role of ACDP4 in essential metal ion transport and homeostasis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...