Property Summary

NCBI Gene PubMed Count 14
PubMed Score 24.34
PubTator Score 9.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.99551461860438E-8
atypical teratoid / rhabdoid tumor 4369 3.15930161186935E-6
osteosarcoma 7933 6.02803504963941E-5
psoriasis 6685 1.57387059445276E-4
glioblastoma 5572 5.29276956054042E-4
primitive neuroectodermal tumor 3031 5.34734260122514E-4
medulloblastoma 1524 8.08838343874839E-4
Multiple myeloma 1328 0.00113795086312104
medulloblastoma, large-cell 6234 0.0018623193909066
lung cancer 4473 0.00272110394093963
Parkinson's disease 364 0.00947128665301152
adult high grade glioma 2148 0.0229151750828731
astrocytic glioma 2241 0.0234327765303859
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0262100119104649
ependymoma 2514 0.0332726452949469
oligodendroglioma 2849 0.0473317964521301
Disease Target Count Z-score Confidence
Leigh disease 81 3.283 1.6

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.683 0.001
astrocytic glioma -1.400 0.023
ependymoma -1.500 0.033
oligodendroglioma -1.200 0.047
psoriasis 1.400 0.000
osteosarcoma 1.966 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.500 0.001
medulloblastoma -1.400 0.001
medulloblastoma, large-cell -1.500 0.002
primitive neuroectodermal tumor -1.300 0.001
pancreatic ductal adenocarcinoma liver m... -1.101 0.026
lung cancer 1.500 0.003
Parkinson's disease -1.100 0.009
adult high grade glioma -1.100 0.023
ovarian cancer -1.600 0.000

Synonym

Accession Q9Y6N1 D3DTY5 I3L220 Q6FHB7 Q9BRX0 Q9UME8
Symbols COX11P

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (4)

PMID Text
22863968 meta-analysis suggested that polymorphism STXBP4/COX11 rs6504950 variant was significantly associated with breast cancer risk; the A allele of rs6504950 decreased the risk of breast cancer
20877624 Observational study of gene-disease association. (HuGE Navigator)
20601676 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19330027 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQP      1 - 70
PRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIE     71 - 140
NMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQ    141 - 210
YFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN        211 - 276
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
22863968 2012 Association of STXBP4/COX11 rs6504950 (G>A) polymorphism with breast cancer risk: evidence from 17,960 cases and 22,713 controls.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20601676 2010 Analysis of SNPs with an effect on gene expression identifies UBE2L3 and BCL3 as potential new risk genes for Crohn's disease.
19330027 2009 Newly discovered breast cancer susceptibility loci on 3p24 and 17q23.2.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15840172 2005 Physical interaction and functional coupling between ACDP4 and the intracellular ion chaperone COX11, an implication of the role of ACDP4 in essential metal ion transport and homeostasis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...