Property Summary

NCBI Gene PubMed Count 32
Grant Count 23
R01 Count 21
Funding $2,193,120.48
PubMed Score 53.48
PubTator Score 50.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Gene RIF (18)

PMID Text
25249183 A meta-analysis of genome-wide association studies of blood pressure and hypertension in Chinese identified three new loci (CACNA1D, CYP21A2, and MED13L) and a newly discovered variant near SLC4A7.
25241983 We demonstrate, for the first time, that 3 different pHi regulators responsible for acid extruding, i.e. NHE and NBC, and MCT, are functionally co-existed in cultured radial artery smooth muscle cells.
24788003 Upregulation of NBCn1 during human breast carcinogenesis contributes to the characteristic acid distribution within human breast carcinomas.
23117855 The SLC4A7 variant rs4973768 is associated with breast cancer risk.
22907202 Na(+),HCO(3)(-)-cotransport is a major determinant of pH(i) in breast cancer.
22383045 Simultaneous switching of the putative transmembrane segment (TM6) and TM12 of NBCe1 for those from NBCn1 severely impairs the expression of the transporter at the plasma membrane.
22120673 Data show that DeltaNErbB2 expression elicited Na(+), HCO(3)(-) cotransporter NBCn1 upregulation, Ser(703)-phosphorylation of Na(+)/H(+) exchanger NHE1.
21224233 The present study generated a series of chimeras of human NBCe1-A and human NBCn1-A (SLC4A7). Replacing the fourth extracellular loop (EL4) of human NBCe1-A with EL4 of NBCn1-A creates an electroneutral NBC.
20542029 NBCn1 inhibition attenuated cathepsin release and had no net effect on viability of MCF7 cells.
20145138 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MERFRLEKKLPGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYIGVHVPFSKESRRRHRHRGHKHHHRR      1 - 70
RKDKESDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMDELCYRDGEEYEWKETARWLKFEE     71 - 140
DVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRASTLDEIADMVLDNMIASGQLDESIRENVRE    141 - 210
ALLKRHHHQNEKRFTSRIPLVRSFADIGKKHSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSL    211 - 280
LLGHLLPSSRAGTPAGSRCTTPVPTPQNSPPSSPSISRLTSRSSQESQRQAPELLVSPASDDIPTVVIHP    281 - 350
PEEDLEAALKGEEQKNEENVDLTPGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMR    351 - 420
KIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQYHEIGRSIAT    421 - 490
LMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKSVPSQEKRKIPVFHNGSTPTL    491 - 560
GETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDFKDALSLQCLASILFLYCACMSPVITFGGLL    561 - 630
GEATEGRISAIESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWT    631 - 700
SFLCIVLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTE    701 - 770
PPNPSNETLAQWKKDNITAHNISWRNLTVSECKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSS    771 - 840
FLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPTHPERGWIISPLGDNPW    841 - 910
WTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGVMLGVCSVMGLPWFVAATVLS    911 - 980
ISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMGLSVFMTSVLKFIPMPVLYGVFLYMGVSSLK    981 - 1050
GIQLFDRIKLFGMPAKHQPDLIYLRYVPLWKVHIFTVIQLTCLVLLWVIKVSAAAVVFPMMVLALVFVRK   1051 - 1120
LMDLCFTKRELSWLDDLMPESKKKKEDDKKKKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPD   1121 - 1190
KPVSVKISFEDEPRKKYVDAETSL                                                 1191 - 1214
//

Publication (44)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25241983 2014 Functional characterization of intracellular pH regulators responsible for acid extrusion in human radial artery smooth muscle cells.
24788003 2015 Na+,HCO3- -cotransport is functionally upregulated during human breast carcinogenesis and required for the inverted pH gradient across the plasma membrane.
24493630 2014 A genome-wide association study of early-onset breast cancer identifies PFKM as a novel breast cancer gene and supports a common genetic spectrum for breast cancer at any age.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23117855 2012 The SLC4A7 variant rs4973768 is associated with breast cancer risk: evidence from a case-control study and a meta-analysis.
22907202 2013 Contribution of Na+,HCO3(-)-cotransport to cellular pH control in human breast cancer: a role for the breast cancer susceptibility locus NBCn1 (SLC4A7).
22383045 2012 Effect of simultaneously replacing putative TM6 and TM12 of human NBCe1-A with those from NBCn1 on surface abundance in Xenopus oocytes.
More...