Property Summary

NCBI Gene PubMed Count 35
PubMed Score 64.65
PubTator Score 50.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Breast cancer -1.300 2.4e-05
adult high grade glioma 1.200 2.0e-04
astrocytoma -1.500 1.0e-02
Astrocytoma, Pilocytic 1.100 2.5e-06
atypical teratoid / rhabdoid tumor 1.100 4.5e-03
Endometriosis -1.527 3.0e-02
ependymoma -1.200 7.1e-03
gastric carcinoma 1.100 1.6e-02
Gaucher disease type 3 -1.500 3.2e-02
glioblastoma 1.400 1.1e-08
group 3 medulloblastoma 1.200 4.2e-03
intraductal papillary-mucinous carcinoma... 1.300 2.5e-02
invasive ductal carcinoma 1.100 6.7e-03
lung cancer 1.200 8.1e-04
malignant mesothelioma -1.300 1.1e-04
medulloblastoma, large-cell 1.500 3.8e-05
non primary Sjogren syndrome sicca -1.500 2.3e-02
osteosarcoma 2.094 7.9e-05
pituitary cancer -1.200 3.1e-05
primitive neuroectodermal tumor 1.100 2.1e-03
psoriasis -1.600 9.2e-05
Rheumatoid arthritis 1.300 3.8e-02
sarcoidosis 1.500 1.3e-02
subependymal giant cell astrocytoma 1.524 1.8e-02

Gene RIF (22)

AA Sequence

MERFRLEKKLPGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYIGVHVPFSKESRRRHRHRGHKHHHRR      1 - 70
RKDKESDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMDELCYRDGEEYEWKETARWLKFEE     71 - 140
DVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRASTLDEIADMVLDNMIASGQLDESIRENVRE    141 - 210
ALLKRHHHQNEKRFTSRIPLVRSFADIGKKHSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSL    211 - 280
LLGHLLPSSRAGTPAGSRCTTPVPTPQNSPPSSPSISRLTSRSSQESQRQAPELLVSPASDDIPTVVIHP    281 - 350
PEEDLEAALKGEEQKNEENVDLTPGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMR    351 - 420
KIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQYHEIGRSIAT    421 - 490
LMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKSVPSQEKRKIPVFHNGSTPTL    491 - 560
GETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDFKDALSLQCLASILFLYCACMSPVITFGGLL    561 - 630
GEATEGRISAIESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWT    631 - 700
SFLCIVLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTE    701 - 770
PPNPSNETLAQWKKDNITAHNISWRNLTVSECKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSS    771 - 840
FLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPTHPERGWIISPLGDNPW    841 - 910
WTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGVMLGVCSVMGLPWFVAATVLS    911 - 980
ISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMGLSVFMTSVLKFIPMPVLYGVFLYMGVSSLK    981 - 1050
GIQLFDRIKLFGMPAKHQPDLIYLRYVPLWKVHIFTVIQLTCLVLLWVIKVSAAAVVFPMMVLALVFVRK   1051 - 1120
LMDLCFTKRELSWLDDLMPESKKKKEDDKKKKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPD   1121 - 1190
KPVSVKISFEDEPRKKYVDAETSL                                                 1191 - 1214
//

Text Mined References (47)

PMID Year Title