Property Summary

NCBI Gene PubMed Count 33
PubMed Score 135.90
PubTator Score 63.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.535 1.5e-06
dermatomyositis 1.800 4.7e-03
Duchenne muscular dystrophy 1.130 1.4e-05
group 4 medulloblastoma -1.100 4.5e-03
invasive ductal carcinoma 1.100 1.5e-02
juvenile dermatomyositis 1.414 2.0e-10
malignant mesothelioma -1.800 1.2e-07
Multiple myeloma 1.075 3.7e-02
osteosarcoma -1.035 2.6e-03
ovarian cancer -1.900 3.9e-04
pancreatic ductal adenocarcinoma liver m... -1.289 3.0e-03
pituitary cancer 1.500 4.4e-05
sarcoidosis 1.300 2.3e-02
spina bifida -1.899 3.5e-02
ulcerative colitis -1.100 3.5e-04

Gene RIF (27)

AA Sequence

MGCWGRNRGRLLCMLALTFMFMVLEVVVSRVTSSLAMLSDSFHMLSDVLALVVALVAERFARRTHATQKN      1 - 70
TFGWIRAEVMGALVNAIFLTGLCFAILLEAIERFIEPHEMQQPLVVLGVGVAGLLVNVLGLCLFHHHSGF     71 - 140
SQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPE    141 - 210
NPRSGDTVEVQVNGNLVREPDHMELEEDRAGQLNMRGVFLHVLGDALGSVIVVVNALVFYFSWKGCSEGD    211 - 280
FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLYTTYPLLKESALILLQTVPKQ    281 - 350
IDIRNLIKELRNVEGVEEVHELHVWQLAGSRIIATAHIKCEDPTSYMEVAKTIKDVFHNHGIHATTIQPE    351 - 420
FASVGSKSSVVPCELACRTQCALKQCCGTLPQAPSGKDAEKTPAVSISCLELSNNLEKKPRRTKAENIPA    421 - 490
VVIEIKNMPNKQPESSL                                                         491 - 507
//

Text Mined References (38)

PMID Year Title