Property Summary

NCBI Gene PubMed Count 30
Grant Count 23
R01 Count 21
Funding $1,712,377.07
PubMed Score 131.46
PubTator Score 63.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 1.075 0.037
malignant mesothelioma -1.800 0.000
osteosarcoma -1.035 0.003
Duchenne muscular dystrophy 1.130 0.000
juvenile dermatomyositis 1.414 0.000
acute quadriplegic myopathy 1.535 0.000
pancreatic ductal adenocarcinoma liver m... -2.008 0.003
sarcoidosis 1.300 0.023
group 4 medulloblastoma -1.100 0.004
spina bifida -1.899 0.035
invasive ductal carcinoma 1.100 0.015
ulcerative colitis -1.200 0.002
ovarian cancer -1.900 0.000
pituitary cancer 1.500 0.000
dermatomyositis 1.800 0.005

Gene RIF (25)

PMID Text
24951051 ZnT-1 extrudes zinc from mammalian cells by functioning as a Zn(2+)/H(+) exchanger.
24488210 Data indicate that zinc transporters ZnT1 and Zip1 were the most abundantly expressed zinc transporters in leukocytes.
23839533 Data indicate that the expression levels of ZnT and ZIP families in the three cell lines, when treated with high concentration of ZnSO4, increased and decreased corresponding to their functions, respectively.
22572848 ZnT-1 augments CaV3.1 and CaV3.2 channel signals by stimulating the Ras-ERK pathways.
22349685 The results of this study showed that signi fi cant positive correlations between ZIP1,ZnT1, and ZnT6 in most brain in patient with Alzheimer's disease.
21462106 the transporter ZnT1 at the basolateral membrane, regulate the amount of zinc released to the portal circulation for systemic distribution
21103883 Differentiated Caco-2 cells tolerate significantly higher levels of zinc compared to undifferentiated Caco-2 cells, which was accompanied by upregulated ZnT-1 and downregulated ZIP1 levels.
21053094 The metallothionein gene had a higher expression in the blood, when compared to zinc transporters ZnT-1, Zip-1, and Zip-3 (p=0.01 in obese patients.
20471814 GSPE and EGCG inhibit the expression of zinc-binding metallothioneins and plasma membrane zinc exporter ZnT1 (SLC30A1).
20201890 ZnT-1 expression was found to be augmented in the atria of atrial tachycardia patients.
More...

AA Sequence

MGCWGRNRGRLLCMLALTFMFMVLEVVVSRVTSSLAMLSDSFHMLSDVLALVVALVAERFARRTHATQKN      1 - 70
TFGWIRAEVMGALVNAIFLTGLCFAILLEAIERFIEPHEMQQPLVVLGVGVAGLLVNVLGLCLFHHHSGF     71 - 140
SQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPE    141 - 210
NPRSGDTVEVQVNGNLVREPDHMELEEDRAGQLNMRGVFLHVLGDALGSVIVVVNALVFYFSWKGCSEGD    211 - 280
FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLYTTYPLLKESALILLQTVPKQ    281 - 350
IDIRNLIKELRNVEGVEEVHELHVWQLAGSRIIATAHIKCEDPTSYMEVAKTIKDVFHNHGIHATTIQPE    351 - 420
FASVGSKSSVVPCELACRTQCALKQCCGTLPQAPSGKDAEKTPAVSISCLELSNNLEKKPRRTKAENIPA    421 - 490
VVIEIKNMPNKQPESSL                                                         491 - 507
//

Text Mined References (35)

PMID Year Title
24951051 2014 ZnT-1 extrudes zinc from mammalian cells functioning as a Zn(2+)/H(+) exchanger.
24488210 2014 The alteration of zinc transporter gene expression is associated with inflammatory markers in obese women.
23839533 2013 Effects of exogenous zinc on cell cycle, apoptosis and viability of MDAMB231, HepG2 and 293 T cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22572848 2012 ZnT-1 enhances the activity and surface expression of T-type calcium channels through activation of Ras-ERK signaling.
22349685 2012 Zinc transporter mRNA levels in Alzheimer's disease postmortem brain.
21462106 2010 Gastrointestinal factors influencing zinc absorption and homeostasis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
21103883 2011 Differentiation- and polarization-dependent zinc tolerance in Caco-2 cells.
More...