Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.19
PubTator Score 2.83

Knowledge Summary

Patent (1,530)

TINX Plot

  Disease (4)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.6e-06
ovarian cancer 8520 2.7e-06
osteosarcoma 7950 2.3e-04
group 4 medulloblastoma 1855 3.7e-04
sarcoidosis 370 3.6e-03
Multiple myeloma 1332 5.3e-03
lung cancer 4740 1.6e-02
Breast cancer 3578 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.1
Amyotrophic lateral sclerosis 451 0.0 1.2
Disease Target Count Z-score Confidence
Hodgkin's lymphoma 15 3.199 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 2.800 2.6e-02
group 4 medulloblastoma 1.100 3.7e-04
lung cancer 1.300 1.6e-02
medulloblastoma, large-cell 1.300 1.6e-06
Multiple myeloma 1.422 5.3e-03
osteosarcoma 1.246 2.3e-04
ovarian cancer -1.200 2.7e-06
sarcoidosis 1.100 3.6e-03

 IMPC Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (1)

AA Sequence

MENKKKDKDKSDDRMARPSGRSGHNTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVA      1 - 70
IKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVL     71 - 140
MIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLT    141 - 210
GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENF    211 - 280
PEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAH    281 - 350
QHRDKMQQSKNQSADHRAAWDSQQANPHHLRAHLAADRHGGSVQVVSSTNGELNTDDPTAGRSNAPITAP    351 - 420
TEVEVMDETKCCCFFKRRKRKTIQRHK                                               421 - 447
//

Text Mined References (23)

PMID Year Title