Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
R01 Count 5
Funding $549,884.33
PubMed Score 9.69
PubTator Score 2.83

Knowledge Summary

Patent (1,530)

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.422 0.005
osteosarcoma 1.246 0.000
medulloblastoma 1.100 0.000
medulloblastoma, large-cell 1.300 0.000
lung cancer 1.300 0.016
sarcoidosis 1.100 0.004
Breast cancer 2.800 0.026
ovarian cancer -1.200 0.000

Synonym

Accession Q9Y6M4 A8K040 B4DSH2 B7Z9Q4 E7EVD0 Q86WZ7 Q9Y6M3 CKI-gamma 3
Symbols CSNK1G3L
CKI-gamma 3

Gene

PDB

2CHL   2IZR   2IZS   2IZT   2IZU   4G16   4G17   4HGL   4HGS  

  TechDev Info (1)

Gary Johnson 233 Kinome profile via MIB/MS Technology

 Collection (1)

Protein-protein Interaction (4)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (1)

PMID Text
23047923 In vitro protein-protein interaction analysis identifies a Vpu-binding host protein casein kinase 1, gamma 3 (CSNK1G3)

AA Sequence

MENKKKDKDKSDDRMARPSGRSGHNTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVA      1 - 70
IKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVL     71 - 140
MIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLT    141 - 210
GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENF    211 - 280
PEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAH    281 - 350
QHRDKMQQSKNQSADHRAAWDSQQANPHHLRAHLAADRHGGSVQVVSSTNGELNTDDPTAGRSNAPITAP    351 - 420
TEVEVMDETKCCCFFKRRKRKTIQRHK                                               421 - 447
//

Publication (23)

PMID Year Title
25500533 2014 Phosphorylation of LRRK2 by casein kinase 1? regulates trans-Golgi clustering via differential interaction with ARHGEF7.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19451621 2009 Reduced expression of the Kinesin-Associated Protein 3 (KIFAP3) gene increases survival in sporadic amyotrophic lateral sclerosis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18239272 2008 A novel consensus phosphorylation motif in sulfatide- and cholesterol-3-sulfate-binding protein substrates for CK1 in vitro.
More...