Property Summary

NCBI Gene PubMed Count 143
Grant Count 7
Funding $2,027,044.44
PubMed Score 54.63
PubTator Score 81.64

Knowledge Summary


No data available


Gene RIF (132)

26889980 IMP2 expression is higher in ovarian and endometrial high-grade serous carcinomas (HGSC) than in ovarian or endometrial endometrioid carcinoma. Knockdown in ovarian HGSC cell line decreased cell proliferation.
26416451 p62/IMP2 stimulates cell migration and reduces cell adhesion, contributing to breast cancer progression.
26160756 Data show that insulin-like growth factor-2-mRNA-binding proteins IGF2BP1, IGF2BP2, and IGF2BP3 are direct targets of microRNA-1275 (miR-1275).
26115082 Our results suggest IGF2BP2 and KCNQ1 polymorphisms might be independent predictors of chemotherapeutic response
26107517 HPV16 Down-Regulates the Insulin-Like Growth Factor Binding Protein 2 to Promote Epithelial Invasion
25721883 Data suggest that autoantibody against IGF2 mRNA-Binding Protein 2 (IMP2/p62) may be a useful serum biomarker for early-stage breast cancer screening and diagnosis.
25719943 Imp2 regulates the activity of IGF2, which further activates PI3K/Akt signaling.
25661373 The IGF2BP2 gene rs4402960 polymorphism increases the breast cancer risk of Chinese females with Han nationality, and is a breast cancer predisposing gene.
25247335 The IGF2BP2 gene rs1470579 and rs4402960 polymorphisms were associated with type 2 diabetes patients and therapeutic efficacy of pioglitazone in this Chinese population
25062844 The present study provided data suggesting that the wild C allele of IGF2BP2 (rs4402960) had a protective effect against T2DM in obese subjects of Chinese Han population.

AA Sequence

IIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK                                   561 - 599

Publication (153)

PMID Year Title
26889980 2016 Similar protein expression profiles of ovarian and endometrial high-grade serous carcinomas.
26416451 2015 p62/IMP2 stimulates cell migration and reduces cell adhesion in breast cancer.
26160756 2015 miR-1275: A single microRNA that targets the three IGF2-mRNA-binding proteins hindering tumor growth in hepatocellular carcinoma.
26115082 2015 Effects of IGF2BP2, KCNQ1 and GCKR polymorphisms on clinical outcome in metastatic gastric cancer treated with EOF regimen.
26107517 2015 HPV16 Down-Regulates the Insulin-Like Growth Factor Binding Protein 2 to Promote Epithelial Invasion in Organotypic Cultures.
25721883 2015 Autoimmune Response to IGF2 mRNA-Binding Protein 2 (IMP2/p62) in Breast Cancer.
25719943 2015 Imp2 regulates GBM progression by activating IGF2/PI3K/Akt pathway.
25661373 2015 Correlation between IGF2BP2 gene polymorphism and the risk of breast cancer in Chinese Han women.
25247335 2014 The effect of IGF2BP2 gene polymorphisms on pioglitazone response in Chinese type 2 diabetes patients.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.