Property Summary

NCBI Gene PubMed Count 143
PubMed Score 54.63
PubTator Score 81.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 6.30246917660995E-27
non-small cell lung cancer 2798 2.59136169179896E-8
Breast cancer 3099 3.04703242364753E-8
pilocytic astrocytoma 3086 9.20727029805456E-6
pancreatic cancer 2300 3.00112672490216E-5
lung cancer 4473 7.86019066122744E-4
psoriasis 6685 8.10926812178917E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00153578346031173
atypical teratoid / rhabdoid tumor 4369 0.00182077001671278
posterior fossa group A ependymoma 1511 0.0022123411807487
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00290128168935122
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00509531928641746
pediatric high grade glioma 2712 0.00570066551971465
Barrett's esophagus 185 0.00917151229262069
glioblastoma 5572 0.010708428616679
esophageal adenocarcinoma 737 0.0176010007179145
osteosarcoma 7933 0.0215995072956431
primitive neuroectodermal tumor 3031 0.0271069582869897
group 3 medulloblastoma 2254 0.0292752304997197
spina bifida 1064 0.0366902696135256
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 4.747 2.4

Expression

Synonym

Accession Q9Y6M1 A0A4Z0 B3FTN2 B3FTN3 B3FTN4 IGF2 mRNA-binding protein 2
Symbols IMP2
IMP-2
VICKZ2

Gene

PDB

2CQH  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid

Gene RIF (132)

PMID Text
26889980 IMP2 expression is higher in ovarian and endometrial high-grade serous carcinomas (HGSC) than in ovarian or endometrial endometrioid carcinoma. Knockdown in ovarian HGSC cell line decreased cell proliferation.
26416451 p62/IMP2 stimulates cell migration and reduces cell adhesion, contributing to breast cancer progression.
26160756 Data show that insulin-like growth factor-2-mRNA-binding proteins IGF2BP1, IGF2BP2, and IGF2BP3 are direct targets of microRNA-1275 (miR-1275).
26115082 Our results suggest IGF2BP2 and KCNQ1 polymorphisms might be independent predictors of chemotherapeutic response
26107517 HPV16 Down-Regulates the Insulin-Like Growth Factor Binding Protein 2 to Promote Epithelial Invasion
25721883 Data suggest that autoantibody against IGF2 mRNA-Binding Protein 2 (IMP2/p62) may be a useful serum biomarker for early-stage breast cancer screening and diagnosis.
25719943 Imp2 regulates the activity of IGF2, which further activates PI3K/Akt signaling.
25661373 The IGF2BP2 gene rs4402960 polymorphism increases the breast cancer risk of Chinese females with Han nationality, and is a breast cancer predisposing gene.
25247335 The IGF2BP2 gene rs1470579 and rs4402960 polymorphisms were associated with type 2 diabetes patients and therapeutic efficacy of pioglitazone in this Chinese population
25062844 The present study provided data suggesting that the wild C allele of IGF2BP2 (rs4402960) had a protective effect against T2DM in obese subjects of Chinese Han population.
More...

AA Sequence

MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIME      1 - 70
VDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKL     71 - 140
SGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIG    141 - 210
KEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKIL    211 - 280
AHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFE    281 - 350
NDMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPH    351 - 420
HHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQG    421 - 490
RIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVR    491 - 560
IIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK                                   561 - 599
//

Text Mined References (153)

PMID Year Title
26889980 2016 Similar protein expression profiles of ovarian and endometrial high-grade serous carcinomas.
26416451 2015 p62/IMP2 stimulates cell migration and reduces cell adhesion in breast cancer.
26160756 2015 miR-1275: A single microRNA that targets the three IGF2-mRNA-binding proteins hindering tumor growth in hepatocellular carcinoma.
26115082 2015 Effects of IGF2BP2, KCNQ1 and GCKR polymorphisms on clinical outcome in metastatic gastric cancer treated with EOF regimen.
26107517 2015 HPV16 Down-Regulates the Insulin-Like Growth Factor Binding Protein 2 to Promote Epithelial Invasion in Organotypic Cultures.
25721883 2015 Autoimmune Response to IGF2 mRNA-Binding Protein 2 (IMP2/p62) in Breast Cancer.
25719943 2015 Imp2 regulates GBM progression by activating IGF2/PI3K/Akt pathway.
25661373 2015 Correlation between IGF2BP2 gene polymorphism and the risk of breast cancer in Chinese Han women.
25247335 2014 The effect of IGF2BP2 gene polymorphisms on pioglitazone response in Chinese type 2 diabetes patients.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
More...