Property Summary

NCBI Gene PubMed Count 13
Grant Count 122
R01 Count 67
Funding $22,351,488.23
PubMed Score 112.49
PubTator Score 511.87

Knowledge Summary


No data available


  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.997 0.000
ovarian cancer 2.800 0.000
psoriasis 1.300 0.000


Accession Q9Y6M0 Q9NS34 Q9P2V6
Symbols ESP1


Gene RIF (6)

25519908 Testisin activates PAR-2, inducing PAR-2 loss from the cell surface, internalization, and cellular signaling.
24663101 Depletion of the PRSS21 expression upregulates HIV-1 CA A92E mutant infectivity in CsA-untreated HeLa cells and downregulates its infectivity in CsA-treated HeLa cells
20211623 Testisin may promote carcinogenesis by inhibiting tumor suppressor activity of maspin.
19571264 These data suggest that aberrant regulation of PRSS21 may underlie certain secondary male infertility syndromes, such as "easily decapitated" spermatozoa in humans.
16810501 The results demonstrate for the first time that aberrant methylation of specific CpG sites near the transcription initiation site is an important factor in testisin gene silencing in TGCT.
15685234 Loss of Testisin is caused, at least in part, by DNA hypermethylation and histone deacetylation, and suggest a tumour suppressor role for Testisin in testicular tumorigenesis.

AA Sequence

IQKLMAQSGMSQPDPSWPLLFFPLLWALPLLGPV                                        281 - 314

Publication (13)

PMID Year Title
25519908 2015 Proteolytic activation of the protease-activated receptor (PAR)-2 by the glycosylphosphatidylinositol-anchored serine protease testisin.
20211623 2010 Interaction of testisin with maspin and its impact on invasion and cell death resistance of cervical cancer cells.
19571264 2009 The glycosylphosphatidylinositol-anchored serine protease PRSS21 (testisin) imparts murine epididymal sperm cell maturation and fertilizing ability.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16810501 2006 Epigenetic silencing of the putative tumor suppressor gene testisin in testicular germ cell tumors.
15685234 2005 Hypermethylation of the 5' CpG island of the gene encoding the serine protease Testisin promotes its loss in testicular tumorigenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11004480 2000 Localization, expression and genomic structure of the gene encoding the human serine protease testisin.