Property Summary

NCBI Gene PubMed Count 13
PubMed Score 118.44
PubTator Score 511.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.997 1.3e-05
ovarian cancer 2.800 4.8e-09
psoriasis 1.300 1.4e-14

Gene RIF (7)

AA Sequence

MGARGALLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVS      1 - 70
LLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIAL     71 - 140
VKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLK    141 - 210
YSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEW    211 - 280
IQKLMAQSGMSQPDPSWPLLFFPLLWALPLLGPV                                        281 - 314
//

Text Mined References (13)

PMID Year Title