Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.61
PubTator Score 5.48

Knowledge Summary


No data available



Accession Q9Y6L7 A6NDK0 Q2M1H1 Q6PJN5 Q9UQ00


Gene RIF (3)

23777486 By means of a cross-species comparative genetic strategy we describe an association for TLL2 with bipolar disorder.
18824173 The crystal structures of the protease domains of human BMP-1 and the closely related Tolloid-like protease 1 (TLL-1), are reported.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

DSLMIRFRTDDTINKKGFHARYTSTKFQDALHMKK                                       981 - 1015

Publication (14)

PMID Year Title
23777486 2013 Cross-species genetics converge to TLL2 for mouse avoidance behavior and human bipolar disorder.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18824173 2008 Structural basis for the substrate specificity of bone morphogenetic protein 1/tolloid-like metalloproteases.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11313359 2001 Multiple bone morphogenetic protein 1-related mammalian metalloproteinases process pro-lysyl oxidase at the correct physiological site and control lysyl oxidase activation in mouse embryo fibroblast cultures.
11076863 2000 DNA cloning using in vitro site-specific recombination.