Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.61
PubTator Score 5.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 7.45943456740121E-11
pilocytic astrocytoma 3086 7.48527287531163E-7
ovarian cancer 8492 1.13480643141742E-6
glioblastoma 5572 9.05624832641862E-6
pediatric high grade glioma 2712 1.68207688261584E-4
medulloblastoma, large-cell 6234 1.73089223161578E-4
medulloblastoma 1524 0.00116949060392189
atypical teratoid / rhabdoid tumor 4369 0.00331806509513207
oligodendroglioma 2849 0.0124602206458822
astrocytic glioma 2241 0.0132457876069928
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0142019769518807
primitive neuroectodermal tumor 3031 0.0453914389595855
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 1.0
Disease Target Count Z-score Confidence
Autosomal recessive non-syndromic intellectual disability 8 4.584 2.3

Expression

Synonym

Accession Q9Y6L7 A6NDK0 Q2M1H1 Q6PJN5 Q9UQ00
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

 MGI Term (1)

 CSPA Cell Line (2)

Gene RIF (3)

PMID Text
23777486 By means of a cross-species comparative genetic strategy we describe an association for TLL2 with bipolar disorder.
18824173 The crystal structures of the protease domains of human BMP-1 and the closely related Tolloid-like protease 1 (TLL-1), are reported.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPRATALGALVSLLLLLPLPRGAGGLGERPDATADYSELDGEEGTEQQLEHYHDPCKAAVFWGDIALDED      1 - 70
DLKLFHIDKARDWTKQTVGATGHSTGGLEEQASESSPDTTAMDTGTKEAGKDGRENTTLLHSPGTLHAAA     71 - 140
KTFSPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIERTDEESFIVFSYR    141 - 210
TCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLK    211 - 280
MEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPA    281 - 350
CGETLQDTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAP    351 - 420
LLGRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAAYEATCGGDMNKDAGQIQSPNYPDDYRPSKEC    421 - 490
VWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCGYEKPEDVKSSSNRLWMKFVS    491 - 560
DGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKCACDPGYELAADKKMCEVACGGFITKLNGT    561 - 630
ITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFVEVRSGLSPDAKLHGRFCGSETP    631 - 700
EVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHD    701 - 770
CKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGP    771 - 840
DSLAPILGRFCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTKELYSHAQFGD    841 - 910
NNYPSEARCDWVIVAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGYDSSAPRLGRFCGSGPLEEIYSAG    911 - 980
DSLMIRFRTDDTINKKGFHARYTSTKFQDALHMKK                                       981 - 1015
//

Text Mined References (14)

PMID Year Title
23777486 2013 Cross-species genetics converge to TLL2 for mouse avoidance behavior and human bipolar disorder.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18824173 2008 Structural basis for the substrate specificity of bone morphogenetic protein 1/tolloid-like metalloproteases.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11313359 2001 Multiple bone morphogenetic protein 1-related mammalian metalloproteinases process pro-lysyl oxidase at the correct physiological site and control lysyl oxidase activation in mouse embryo fibroblast cultures.
11076863 2000 DNA cloning using in vitro site-specific recombination.
More...