Property Summary

NCBI Gene PubMed Count 248
Grant Count 355
R01 Count 248
Funding $42,432,425
PubMed Score 1121.70
PubTator Score 827.12

Knowledge Summary

Patent

No data available

Synonym

Accession Q9Y6K9 Q7LBY6 Q7Z7F1 NEMO
Symbols IP
IP1
IP2
FIP3
IKKG
IPD2
NEMO
FIP-3
Fip3p
IMD33
AMCBX1
IKKAP1
ZC2HC9
IKK-gamma

Gene

PDB

2JVX   2JVY   3BRT   3BRV   3CL3   3FX0   4BWN   5AAY  

Gene RIF (160)

PMID Text
26865630 results further reveal that cFLIPLrequires the linear ubiquitin chain assembly complex and the kinase TAK1 for activation of the IKK kinase
26802121 Recruitment of A20 to the C-terminal domain of NEMO represents a novel mechanism limiting NF-kappaB activation by NEMO, and its absence results in autoinflammatory disease.
26564087 Deletion of exons 4 to 10 (NEMODelta4-10) accounts for about 80% of cases (familial and sporadic) of Incontinentia pigmenti.
26258637 Authors show that Rab11-GMPPNP-FIP3-Rabin8 is more stable than Rab11-GMPPNP-Rabin8, owing to direct interaction between Rabin8 and FIP3 within the dual effector-bound complex.
26240016 USP18 negatively regulates NF-kappaB signaling by targeting TAK1 and NEMO for deubiquitination through distinct mechanisms.
26117626 A novel mutation, designated c.916G>A (p.D306N) is described. NEMO expression was unaffected, but ubiquitylation was decreased causing ectodermal dysplasia, immunodeficiency, incontinentia pigmenti, and immune thrombocytopenic purpura.
26060253 IPO3 binds NEMO, promotes its nuclear import, and is critical for DNA damage-dependent NF-kappaB activation.
26060140 COMMD7's binding to NEMO does not interfere with the binding to the IKKs, and that the disruption of the IKK complex through the use of the NBP competitor impairs the termination of NF-kappaB activity
25979343 IKKgamma is a parallel coiled-coil whose response to binding of vFLIP or IKKbeta is localized twisting.
25944529 Somatic mosaicism of a novel IKBKG nonsense mutation in a male patient with incontinentia pigmenti.
More...

AA Sequence

MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQ      1 - 70
ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKA     71 - 140
SVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE    141 - 210
AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV    211 - 280
IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES    281 - 350
ARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE     351 - 419
//

Publication (271)

PMID Year Title
27070702 2016 Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma.
26865630 2016 Distinct Activation Mechanisms of NF-?B Regulator Inhibitor of NF-?B Kinase (IKK) by Isoforms of the Cell Death Regulator Cellular FLICE-like Inhibitory Protein (cFLIP).
26802121 2016 Recruitment of A20 by the C-terminal domain of NEMO suppresses NF-?B activation and autoinflammatory disease.
26564087 2015 Incontinentia pigmenti (Bloch-Sulzberger syndrome).
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26258637 2015 Structure of Rab11-FIP3-Rabin8 reveals simultaneous binding of FIP3 and Rabin8 effectors to Rab11.
26240016 2015 USP18 negatively regulates NF-?B signaling by targeting TAK1 and NEMO for deubiquitination through distinct mechanisms.
26117626 2015 Novel hypomorphic mutation in IKBKG impairs NEMO-ubiquitylation causing ectodermal dysplasia, immunodeficiency, incontinentia pigmenti, and immune thrombocytopenic purpura.
26060253 2015 IPO3-mediated Nonclassical Nuclear Import of NF-?B Essential Modulator (NEMO) Drives DNA Damage-dependent NF-?B Activation.
26060140 2016 COMMD7 as a novel NEMO interacting protein involved in the termination of NF-?B signaling.
More...