Property Summary

NCBI Gene PubMed Count 31
Grant Count 2
R01 Count 2
Funding $197,602.33
PubMed Score 13.08
PubTator Score 114.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
systemic lupus erythematosus 1.500 0.000
malignant mesothelioma 3.300 0.000
psoriasis 2.500 0.000
cutaneous lupus erythematosus 3.300 0.000
osteosarcoma 1.399 0.002
posterior fossa group A ependymoma 1.400 0.000
glioblastoma 1.900 0.000
atypical teratoid / rhabdoid tumor 1.100 0.002
juvenile dermatomyositis 2.406 0.000
Atopic dermatitis 1.600 0.000
tuberculosis 2.100 0.001
intraductal papillary-mucinous neoplasm ... 1.200 0.024
lung cancer -2.200 0.000
pancreatic cancer 1.300 0.000
Multiple Sclerosis 3.000 0.008
cystic fibrosis 1.500 0.002
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.200 0.000
primary Sjogren syndrome 1.400 0.001
lung adenocarcinoma 1.100 0.000
Breast cancer 1.800 0.000
lung carcinoma -1.100 0.000
breast carcinoma 1.300 0.000
invasive ductal carcinoma 1.100 0.017
ulcerative colitis 1.400 0.000
dermatomyositis 1.100 0.023

Synonym

Accession Q9Y6K5 Q2HJ14 Q9H3P5 (2-5')oligo(A) synthase 3
Symbols p100
p100OAS

Gene

 Grant Application (2)

PDB

4S3N  

Gene RIF (19)

PMID Text
26858407 OAS3 displayed a higher affinity for dsRNA in intact cells than either OAS1 or OAS2, consistent with its dominant role in RNase L activation.
26398832 Preliminary study suggests that OAS gene cluster and CD209 gene polymorphisms influence the risk of developing clinical symptoms in Chikungunya virus-infected patients.
26116899 HIV-1 Vpr upregulates the gene expression of OAS3 in human monocyte-derived dendritic cells
26063222 By means of an allelic association study of a cohort of 740 patients with dengue, the authors found a protective effect of OAS3_R381 against shock.
25363670 Common variation at 12q24.13 (OAS3 intron) influences chronic lymphocytic leukemia risk.
25275129 The combined high affinity for double-stranded RNA and the capability to produce 2'-5'-linked oligoadenylates of sufficient length to activate RNase L suggests that OAS3 is a potent activator of RNase L.
24162774 HIV-1 Vpr upregulates the gene expression of OAS3 in human monocyte-derived dendritic cells
23337612 The results suggest that OAS1-OAS3-OAS2 haplotypes are associated with differential susceptibility to clinical outcomes of dengue infection.
23196181 among the members of the OAS family, OAS1 p46 and OAS3 p100 mediate the RNase L-dependent antiviral activity against HCV
21050126 The data suggest a possible association between OAS2 and OAS3 single nucleotide polymorphisms and the outcome of tick-borne encephalitis virus infection in a Russian population.
More...

AA Sequence

MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKGGSSGRGTALK      1 - 70
GGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLED     71 - 140
WMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWY    141 - 210
HQVCLQGLWKETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAV    211 - 280
GQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGC    281 - 350
SGLGHPIQLDPNQKTPENSKSLNAVYPRAGSKPPSCPAPGPTGAASIVPSVPGMALDLSQIPTKELDRFI    351 - 420
QDHLKPSPQFQEQVKKAIDIILRCLHENCVHKASRVSKGGSFGRGTDLRDGCDVELIIFLNCFTDYKDQG    421 - 490
PRRAEILDEMRAQLESWWQDQVPSLSLQFPEQNVPEALQFQLVSTALKSWTDVSLLPAFDAVGQLSSGTK    491 - 560
PNPQVYSRLLTSGCQEGEHKACFAELRRNFMNIRPVKLKNLILLVKHWYRQVAAQNKGKGPAPASLPPAY    561 - 630
ALELLTIFAWEQGCRQDCFNMAQGFRTVLGLVQQHQQLCVYWTVNYSTEDPAMRMHLLGQLRKPRPLVLD    631 - 700
PADPTWNVGHGSWELLAQEAAALGMQACFLSRDGTSVQPWDVMPALLYQTPAGDLDKFISEFLQPNRQFL    701 - 770
AQVNKAVDTICSFLKENCFRNSPIKVIKVVKGGSSAKGTALRGRSDADLVVFLSCFSQFTEQGNKRAEII    771 - 840
SEIRAQLEACQQERQFEVKFEVSKWENPRVLSFSLTSQTMLDQSVDFDVLPAFDALGQLVSGSRPSSQVY    841 - 910
VDLIHSYSNAGEYSTCFTELQRDFIISRPTKLKSLIRLVKHWYQQCTKISKGRGSLPPQHGLELLTVYAW    911 - 980
EQGGKDSQFNMAEGFRTVLELVTQYRQLCIYWTINYNAKDKTVGDFLKQQLQKPRPIILDPADPTGNLGH    981 - 1050
NARWDLLAKEAAACTSALCCMGRNGIPIQPWPVKAAV                                    1051 - 1087
//

Publication (37)

PMID Year Title
26858407 2016 Activation of RNase L is dependent on OAS3 expression during infection with diverse human viruses.
26398832 2016 Association of Oligoadenylate Synthetase Gene Cluster and DC-SIGN (CD209) Gene Polymorphisms with Clinical Symptoms in Chikungunya Virus Infection.
26063222 2015 High Anti-Dengue Virus Activity of the OAS Gene Family Is Associated With Increased Severity of Dengue.
25363670 2015 Common variation at 12q24.13 (OAS3) influences chronic lymphocytic leukemia risk.
25275129 2014 The 2'-5'-oligoadenylate synthetase 3 enzyme potently synthesizes the 2'-5'-oligoadenylates required for RNase L activation.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23337612 2013 Polymorphisms in the oligoadenylate synthetase gene cluster and its association with clinical outcomes of dengue virus infection.
23196181 2013 The ribonuclease L-dependent antiviral roles of human 2',5'-oligoadenylate synthetase family members against hepatitis C virus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
More...