Property Summary

NCBI Gene PubMed Count 34
PubMed Score 17.83
PubTator Score 114.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma 1.200 4.8e-05
Astrocytoma, Pilocytic 1.200 4.0e-05
Atopic dermatitis 1.600 3.2e-04
atypical teratoid / rhabdoid tumor 1.100 2.2e-03
Breast cancer 1.800 3.7e-09
breast carcinoma 1.300 2.0e-22
cutaneous lupus erythematosus 3.300 7.3e-06
cystic fibrosis 1.500 1.9e-03
dermatomyositis 1.100 2.3e-02
ependymoma 1.200 2.8e-04
glioblastoma 1.500 3.1e-08
intraductal papillary-mucinous neoplasm ... 1.200 2.4e-02
invasive ductal carcinoma 1.100 1.7e-02
juvenile dermatomyositis 2.406 2.5e-14
lung adenocarcinoma 1.100 1.2e-04
lung cancer -1.800 3.9e-03
lung carcinoma -1.100 8.0e-09
malignant mesothelioma 3.300 3.0e-09
Multiple Sclerosis 3.000 8.0e-03
osteosarcoma 1.399 1.6e-03
pancreatic cancer 1.300 1.3e-04
primary Sjogren syndrome 1.400 1.3e-03
psoriasis 2.500 6.1e-08
Systemic lupus erythematosus 1.500 4.7e-04
tuberculosis 2.100 5.4e-04
ulcerative colitis 1.400 7.8e-06

Gene RIF (22)

AA Sequence

MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKGGSSGRGTALK      1 - 70
GGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLED     71 - 140
WMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWY    141 - 210
HQVCLQGLWKETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAV    211 - 280
GQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGC    281 - 350
SGLGHPIQLDPNQKTPENSKSLNAVYPRAGSKPPSCPAPGPTGAASIVPSVPGMALDLSQIPTKELDRFI    351 - 420
QDHLKPSPQFQEQVKKAIDIILRCLHENCVHKASRVSKGGSFGRGTDLRDGCDVELIIFLNCFTDYKDQG    421 - 490
PRRAEILDEMRAQLESWWQDQVPSLSLQFPEQNVPEALQFQLVSTALKSWTDVSLLPAFDAVGQLSSGTK    491 - 560
PNPQVYSRLLTSGCQEGEHKACFAELRRNFMNIRPVKLKNLILLVKHWYRQVAAQNKGKGPAPASLPPAY    561 - 630
ALELLTIFAWEQGCRQDCFNMAQGFRTVLGLVQQHQQLCVYWTVNYSTEDPAMRMHLLGQLRKPRPLVLD    631 - 700
PADPTWNVGHGSWELLAQEAAALGMQACFLSRDGTSVQPWDVMPALLYQTPAGDLDKFISEFLQPNRQFL    701 - 770
AQVNKAVDTICSFLKENCFRNSPIKVIKVVKGGSSAKGTALRGRSDADLVVFLSCFSQFTEQGNKRAEII    771 - 840
SEIRAQLEACQQERQFEVKFEVSKWENPRVLSFSLTSQTMLDQSVDFDVLPAFDALGQLVSGSRPSSQVY    841 - 910
VDLIHSYSNAGEYSTCFTELQRDFIISRPTKLKSLIRLVKHWYQQCTKISKGRGSLPPQHGLELLTVYAW    911 - 980
EQGGKDSQFNMAEGFRTVLELVTQYRQLCIYWTINYNAKDKTVGDFLKQQLQKPRPIILDPADPTGNLGH    981 - 1050
NARWDLLAKEAAACTSALCCMGRNGIPIQPWPVKAAV                                    1051 - 1087
//

Text Mined References (41)

PMID Year Title