Property Summary

NCBI Gene PubMed Count 237
Grant Count 220
R01 Count 123
Funding $39,604,756.99
PubMed Score 625.63
PubTator Score 435.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession Q9Y6K1 E9PEB8 Q86TE8 Q86XF5 Q8IZV0 Q8WXU9 Dnmt3a
Symbols TBRS
DNMT3A2
M.HsaIIIA

Gene

PDB

2QRV   3A1A   3A1B   3LLR   3SVM   4QBQ   4QBR   4QBS   4U7P   4U7T  

Gene RIF (212)

PMID Text
27010239 DNMT3A mutants can block the differentiation of HSCs and leukaemic cells via PRC1.
26927545 Data suggest that microRNA miR-101 may inhibit MDA-MB-231 breast cancer cell proliferation and migration by repressing DNA methyltransferase 3a (DNMT3a) expression and up-regulating E-cadherin expression.
26825711 Among 864 Dutch persons between 80 and 105.8 years of age, DNA sequence analysis of DNMT3A confirmed a high incidence of somatic mutations but no effect on 10-year survival.
26823816 Our findings first demonstrated that DNMT3a rs1550117 polymorphism may be a potential biomarker in predicting overall survival of gastric cancer patients
26711182 DNMT3A is frequently mutated in T-ALL and is associated with distinct clinicopathologic entities and a poor prognosis.
26573490 The HBVX gene upregulated the mRNA and protein expression levels of DNMT3A/3B, downregulated the expression of SOCS1 and increased SOCS1 gene promoter CpG island methylation.
26573388 DNMT3a is a direct target of miR143.
26482067 DNMT3A mutations provides the first proof-of-principle investigation on the identification of preleukemic stem cells in Acute myeloid leukemia patients.
26416384 To correlate DNMTs expression with DNA methylation, DNMT1, DNMT3A and DNMT3B mRNA levels in 5 colorectal cancer cell lines; results suggest that cellular DNMT expression is positively correlated with global DNA methylation level but not with regional DNA hypermethylation at each locus.
26375248 DNMT3A mutation was a poor prognostic factor in MLL-partial tandem duplication Acute myeloid leukemia.
More...

AA Sequence

MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPA      1 - 70
VISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPK     71 - 140
EGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARW    141 - 210
KREAEKKAKVIAGMNAVEENQGPGESQKVEEASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDD    211 - 280
EPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSF    281 - 350
CSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPK    351 - 420
GLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEVRQKCRNI    421 - 490
EDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCV    491 - 560
ECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEK    561 - 630
RKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGP    631 - 700
FDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDIS    701 - 770
RFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSI    771 - 840
KQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFA    841 - 910
CV                                                                        911 - 912
//

Text Mined References (247)

PMID Year Title
27010239 2016 DNMT3A R882 mutants interact with polycomb proteins to block haematopoietic stem and leukaemic cell differentiation.
26927545 2016 [miR-101 inhibits the proliferation and migration of breast cancer cells via downregulating the expression of DNA methyltransferase 3a].
26825711 2016 Uncompromised 10-year survival of oldest old carrying somatic mutations in DNMT3A and TET2.
26823816 2015 DNA methyltransferase 3a rs1550117 genetic polymorphism predicts poor survival in gastric cancer patients.
26711182 2016 Clinicopathologic Effect of DNMT3A Mutation in Adult T-Cell Acute Lymphoblastic Leukemia.
26573490 2016 Hepatitis B virus X protein upregulates DNA methyltransferase 3A/3B and enhances SOCS-1CpG island methylation.
26573388 2016 A regulatory circuit involving miR-143 and DNMT3a mediates vascular smooth muscle cell proliferation induced by homocysteine.
26482067 2015 Mutant DNA methylation regulators endow hematopoietic stem cells with the preleukemic stem cell property, a requisite of leukemia initiation and relapse.
26416384 2015 Association of DNA methyltransferases expression with global and gene-specific DNA methylation in colorectal cancer cells.
26375248 2015 High frequency of additional gene mutations in acute myeloid leukemia with MLL partial tandem duplication: DNMT3A mutation is associated with poor prognosis.
More...