Property Summary

NCBI Gene PubMed Count 9
PubMed Score 46.83
PubTator Score 6.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 3.7e-03
glioblastoma -1.100 1.7e-03
group 4 medulloblastoma -1.100 1.5e-02
intraductal papillary-mucinous carcinoma... 1.100 2.8e-03
medulloblastoma, large-cell -1.700 1.6e-05
Multiple myeloma 1.026 2.5e-03
osteosarcoma -1.199 1.1e-03
ovarian cancer -1.100 4.0e-06
Waldenstrons macroglobulinemia 1.050 5.6e-03

Protein-protein Interaction (3)

Gene RIF (4)

AA Sequence

MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQG      1 - 70
YWEWLVRRVPSWIAPNLITIIGLSINICTTILLVFYCPTATEQAPLWAYIACACGLFIYQSLDAIDGKQA     71 - 140
RRTNSSSPLGELFDHGCDSLSTVFVVLGTCIAVQLGTNPDWMFFCCFAGTFMFYCAHWQTYVSGTLRFGI    141 - 210
IDVTEVQIFIIIMHLLAVIGGPPFWQSMIPVLNIQMKIFPALCTVAGTIFSCTNYFRVIFTGGVGKNGST    211 - 280
IAGTSVLSPFLHIGSVITLAAMIYKKSAVQLFEKHPCLYILTFGFVSAKITNKLVVAHMTKSEMHLHDTA    281 - 350
FIGPALLFLDQYFNSFIDEYIVLWIALVFSFFDLIRYCVSVCNQIASHLHIHVFRIKVSTAHSNHH        351 - 416
//

Text Mined References (16)

PMID Year Title