Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.39
PubTator Score 6.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.52538790066895E-6
ovarian cancer 8492 9.04118089075739E-6
tuberculosis 1563 2.09024049242934E-4
invasive ductal carcinoma 2950 4.60166919801856E-4
group 3 medulloblastoma 2254 0.0109855200276616

Expression

  Differential Expression (5)

Disease log2 FC p
tuberculosis 1.100 0.000
group 3 medulloblastoma 1.200 0.011
posterior fossa group B ependymoma 1.200 0.000
invasive ductal carcinoma 1.200 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q9Y6J8 Q9UBP1 Q9UK06 Q9UK07 Q9UKG2 Q9UKG3
Symbols DUSP24
MKSTYX
MK-STYX

Gene

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (5)

PMID Text
25724587 this study revealed STYXL1 as a novel candidate gene for moderate intellectual disability, seizures and behavioral complexities.
24709986 our data support a model in which MK-STYX controls apoptosis by negatively regulating PTPMT1.
23163895 The pseudophosphatase MK-STYX plays a key role in the cellular response to stress.
21262771 MK-STYX regulates mitochondrial outer membrane permeabilization using a distinct mechanism.
20180778 Results illustrated a role for MK-STYX in regulating the ability of G3BP1 to integrate changes in growth-factor stimulation and environmental stress with the regulation of protein synthesis.

AA Sequence

MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLEC      1 - 70
VKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHF     71 - 140
LRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLH    141 - 210
IRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCK    211 - 280
NNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY                                         281 - 313
//

Text Mined References (14)

PMID Year Title
25724587 2015 Homozygous missense mutation in STYXL1 associated with moderate intellectual disability, epilepsy and behavioural complexities.
24709986 2014 The pseudophosphatase MK-STYX physically and genetically interacts with the mitochondrial phosphatase PTPMT1.
23163895 2013 The pseudophosphatase MK-STYX inhibits stress granule assembly independently of Ser149 phosphorylation of G3BP-1.
21262771 2011 MK-STYX, a catalytically inactive phosphatase regulating mitochondrially dependent apoptosis.
20180778 2010 The pseudophosphatase MK-STYX interacts with G3BP and decreases stress granule formation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16341674 2005 Transcriptome analysis of human gastric cancer.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...