Property Summary

NCBI Gene PubMed Count 14
Grant Count 8
R01 Count 8
Funding $1,730,281
PubMed Score 5.39
PubTator Score 6.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
tuberculosis 1.100 0.000
group 3 medulloblastoma 1.200 0.011
posterior fossa group B ependymoma 1.200 0.000
invasive ductal carcinoma 1.200 0.000
ovarian cancer 1.600 0.000

Gene RIF (5)

PMID Text
25724587 this study revealed STYXL1 as a novel candidate gene for moderate intellectual disability, seizures and behavioral complexities.
24709986 our data support a model in which MK-STYX controls apoptosis by negatively regulating PTPMT1.
23163895 The pseudophosphatase MK-STYX plays a key role in the cellular response to stress.
21262771 MK-STYX regulates mitochondrial outer membrane permeabilization using a distinct mechanism.
20180778 Results illustrated a role for MK-STYX in regulating the ability of G3BP1 to integrate changes in growth-factor stimulation and environmental stress with the regulation of protein synthesis.

AA Sequence

MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLEC      1 - 70
VKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHF     71 - 140
LRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLH    141 - 210
IRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCK    211 - 280
NNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY                                         281 - 313
//

Text Mined References (14)

PMID Year Title
25724587 2015 Homozygous missense mutation in STYXL1 associated with moderate intellectual disability, epilepsy and behavioural complexities.
24709986 2014 The pseudophosphatase MK-STYX physically and genetically interacts with the mitochondrial phosphatase PTPMT1.
23163895 2013 The pseudophosphatase MK-STYX inhibits stress granule assembly independently of Ser149 phosphorylation of G3BP-1.
21262771 2011 MK-STYX, a catalytically inactive phosphatase regulating mitochondrially dependent apoptosis.
20180778 2010 The pseudophosphatase MK-STYX interacts with G3BP and decreases stress granule formation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16341674 2005 Transcriptome analysis of human gastric cancer.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...