Property Summary

NCBI Gene PubMed Count 79
Grant Count 81
R01 Count 70
Funding $7,996,359.79
PubMed Score 86.94
PubTator Score 92.19

Knowledge Summary

Patent (6,686)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.400 0.025
active Crohn's disease -1.006 0.036
gastric carcinoma -5.300 0.046

Synonym

Accession Q9Y6J6 A5H1P3 D3DSF8 Q52LJ5
Symbols LQT5
LQT6
ATFB4
MIRP1

Gene

PDB

2M0Q  

Gene RIF (62)

PMID Text
26123744 KCNE2 has been widely studied since its role in the heart was discovered; it is association with inherited and acquired human Long QT syndrome; physiological analyses together with genetics studies have uncovered a startling array of functions for KCNE2, in the heart, stomach, thyroid and choroid plexus. [Review]
24937480 Women with elevated BMI have enhanced hERG activity as a result of low beta-inhibitory protein expression, which likely contributes to weak contractions and poor labour outcomes.
24827085 The transmembrane domains (TMDs) of KCNE1 and KCNE2 were illustrated to associate with the KCNQ1 channel in different modes.
24796621 The effect of KCNE2 mutations on KV7.1 was abolished in the presence of the major IKs beta-subunit KCNE1, when coexpressed in a 1:1:1 molar ratio.
24631769 M54T MiRP1 mutation axecerbate drug-induced long QT syndrome and arrhythmia.
24460807 Mutations in KCNE2 has been shown to cause familial atrial fibrillation.
23890619 study concluded that the variants in KCNQ1, KCNH2, KCNE1 and KCNE2 genes may be correlated with the occurrence of part of sudden unexplained nocturnal death syndrome cases in southern China
23714088 Subjects with LQT-PM may have longer QTc intervals at rest and at peak exercise and all phases of the recovery period compared to controls. Those with homozygous SNPs (KCNE2 1%) had longer resting QTc intervals when compared to heterozygotes.
23504710 KCNE1 and KCNE2, auxiliary subunits of voltage-gated potassium channels, undergo sequential cleavage mediated by either alpha-secretase and presenilin(PS)/gamma-secretase or BACE1 and PS/gamma-secretase in cells.
23483772 Case Report: reduced expression of KCNE2 in surgically excised tissue from human gastric cancer associated with gastritis cystica profunda.
More...

AA Sequence

MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVS      1 - 70
TVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP                      71 - 123
//

Publication (79)

PMID Year Title
26123744 2015 The KCNE2 K? channel regulatory subunit: Ubiquitous influence, complex pathobiology.
24937480 2014 Diminished hERG K+ channel activity facilitates strong human labour contractions but is dysregulated in obese women.
24827085 2014 Differential modulations of KCNQ1 by auxiliary proteins KCNE1 and KCNE2.
24796621 2014 Gain-of-function mutations in potassium channel subunit KCNE2 associated with early-onset lone atrial fibrillation.
24631769 2014 In silico screening of the impact of hERG channel kinetic abnormalities on channel block and susceptibility to acquired long QT syndrome.
24460807 2014 Single nucleotide polymorphisms in proximity to K-channel genes are associated with decreased longitudinal QTc variance.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23890619 2013 Postmortem molecular analysis of KCNQ1, KCNH2, KCNE1 and KCNE2 genes in sudden unexplained nocturnal death syndrome in the Chinese Han population.
23714088 2013 Do LQTS gene single nucleotide polymorphisms alter QTc intervals at rest and during exercise stress testing?
23504710 2013 BACE1 and presenilin/?-secretase regulate proteolytic processing of KCNE1 and 2, auxiliary subunits of voltage-gated potassium channels.
More...