Property Summary

NCBI Gene PubMed Count 82
PubMed Score 91.39
PubTator Score 92.19

Knowledge Summary

Patent (6,686)

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease -1.006 3.6e-02
gastric carcinoma -5.300 4.6e-02
intraductal papillary-mucinous adenoma (... 1.400 2.5e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (65)

AA Sequence

MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVS      1 - 70
TVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP                      71 - 123
//

Text Mined References (82)

PMID Year Title