Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

AA Sequence

MHKQPKLLPPPATPPPPPQSSSWSGNIVFTIKINIWLRVFSHSSPTGLPKPHSPMPSPPEPEHSVGKPAN      1 - 70
VQIPQVSSPEFCNQKSVLATEHAQT                                                  71 - 95
//

Publication (1)

PMID Year Title
10049768 1999 An antisense transcript to SMAD5 expressed in fetal and tumor tissues.