Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
cutaneous lupus erythematosus 1056 0.0085425687362456
Disease Target Count Z-score Confidence
Corneal edema 14 3.121 1.6

AA Sequence

MHKQPKLLPPPATPPPPPQSSSWSGNIVFTIKINIWLRVFSHSSPTGLPKPHSPMPSPPEPEHSVGKPAN      1 - 70
VQIPQVSSPEFCNQKSVLATEHAQT                                                  71 - 95
//

Text Mined References (1)

PMID Year Title
10049768 1999 An antisense transcript to SMAD5 expressed in fetal and tumor tissues.