Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.07
PubTator Score 0.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y6I9 B3KN87 Q9UKD7
Symbols ZSIG11

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSI      1 - 70
SPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTT     71 - 140
ILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAID    141 - 210
TQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEG    211 - 280
EGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE                                         281 - 313
//

Text Mined References (15)

PMID Year Title