Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.00
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 6.71176016748816E-13
osteosarcoma 7933 2.2739596838573E-6
psoriasis 6685 1.0105140554141E-5
interstitial cystitis 2299 9.14900476029462E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.7685461101089E-4
lung cancer 4473 0.00871177596698853
aldosterone-producing adenoma 664 0.026304646709019
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 2.500 0.000
osteosarcoma 1.590 0.000
non-small cell lung cancer -1.002 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.001
lung cancer -1.100 0.009
interstitial cystitis -1.200 0.000
aldosterone-producing adenoma -1.047 0.026

Synonym

Accession Q9Y6I8 A2A2I7 Q9H0T4
Symbols PMP24

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

AA Sequence

MAAPPQLRALLVVVNALLRKRRYHAALAVLKGFRNGAVYGAKIRAPHALVMTFLFRNGSLQEKLWAILQA      1 - 70
TYIHSWNLARFVFTYKGLRALQSYIQGKTYPAHAFLAAFLGGILVFGENNNINSQINMYLLSRVLFALSR     71 - 140
LAVEKGYIPEPRWDPFPLLTAVVWGLVLWLFEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRP    141 - 210
SN                                                                        211 - 212
//

Text Mined References (13)

PMID Year Title
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
20054818 2010 Methylation of a single intronic CpG mediates expression silencing of the PMP24 gene in prostate cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14712230 2004 PMP24, a gene identified by MSRF, undergoes DNA hypermethylation-associated gene silencing during cancer progression in an LNCaP model.
14709540 2004 PEX19 is a predominantly cytosolic chaperone and import receptor for class 1 peroxisomal membrane proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...