Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.00
PubTator Score 2.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
aldosterone-producing adenoma -1.047 2.6e-02
interstitial cystitis -1.200 9.1e-05
intraductal papillary-mucinous neoplasm ... 1.300 6.8e-04
lung cancer -1.100 8.7e-03
non-small cell lung cancer -1.002 6.7e-13
osteosarcoma 1.590 2.3e-06
psoriasis 2.500 1.0e-05

AA Sequence

MAAPPQLRALLVVVNALLRKRRYHAALAVLKGFRNGAVYGAKIRAPHALVMTFLFRNGSLQEKLWAILQA      1 - 70
TYIHSWNLARFVFTYKGLRALQSYIQGKTYPAHAFLAAFLGGILVFGENNNINSQINMYLLSRVLFALSR     71 - 140
LAVEKGYIPEPRWDPFPLLTAVVWGLVLWLFEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRP    141 - 210
SN                                                                        211 - 212
//

Text Mined References (13)

PMID Year Title