Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.00
PubTator Score 2.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 2.500 0.000
osteosarcoma 1.590 0.000
non-small cell lung cancer -1.002 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.001
lung cancer -1.100 0.009
interstitial cystitis -1.200 0.000
aldosterone-producing adenoma -1.047 0.026

Synonym

Accession Q9Y6I8 A2A2I7 Q9H0T4
Symbols PMP24

Gene

AA Sequence

MAAPPQLRALLVVVNALLRKRRYHAALAVLKGFRNGAVYGAKIRAPHALVMTFLFRNGSLQEKLWAILQA      1 - 70
TYIHSWNLARFVFTYKGLRALQSYIQGKTYPAHAFLAAFLGGILVFGENNNINSQINMYLLSRVLFALSR     71 - 140
LAVEKGYIPEPRWDPFPLLTAVVWGLVLWLFEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRP    141 - 210
SN                                                                        211 - 212
//

Text Mined References (13)

PMID Year Title
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
20054818 2010 Methylation of a single intronic CpG mediates expression silencing of the PMP24 gene in prostate cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14712230 2004 PMP24, a gene identified by MSRF, undergoes DNA hypermethylation-associated gene silencing during cancer progression in an LNCaP model.
14709540 2004 PEX19 is a predominantly cytosolic chaperone and import receptor for class 1 peroxisomal membrane proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...