Property Summary

NCBI Gene PubMed Count 33
PubMed Score 13.27
PubTator Score 13.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Dental caries 164 0.0 1.9
Myeloid Leukemia 19 0.0 3.0

Expression

  Differential Expression (40)

Disease log2 FC p
acute quadriplegic myopathy 1.231 3.4e-05
adult high grade glioma 1.400 3.8e-02
Amyotrophic lateral sclerosis 1.194 2.2e-06
astrocytic glioma 2.400 1.6e-02
Astrocytoma, Pilocytic 1.700 6.4e-04
atypical teratoid / rhabdoid tumor 2.200 2.0e-03
autosomal dominant Emery-Dreifuss muscul... 1.134 7.5e-03
Breast cancer -1.400 1.2e-06
breast carcinoma -1.100 5.1e-16
colon cancer -1.100 2.1e-03
cystic fibrosis 1.174 7.7e-05
dermatomyositis 1.400 3.4e-03
Duchenne muscular dystrophy 1.311 4.3e-07
ependymoma 2.600 3.2e-03
gastric carcinoma 1.300 3.6e-02
Gaucher disease type 1 -2.000 4.6e-02
glioblastoma 1.400 1.9e-02
group 3 medulloblastoma 1.300 2.9e-02
hepatocellular carcinoma 1.300 8.0e-03
intraductal papillary-mucinous adenoma (... 1.500 5.7e-03
intraductal papillary-mucinous carcinoma... 1.100 1.5e-02
juvenile dermatomyositis 1.502 1.6e-11
lung adenocarcinoma 1.264 2.8e-04
lung cancer -1.400 1.3e-03
malignant mesothelioma -1.500 5.9e-05
medulloblastoma, large-cell 1.500 6.6e-03
non-small cell lung cancer -1.469 8.0e-09
oligodendroglioma 3.200 6.7e-04
osteosarcoma 1.792 4.1e-04
ovarian cancer -4.000 7.5e-15
pancreatic cancer 1.200 1.1e-02
pancreatic ductal adenocarcinoma liver m... 1.905 3.0e-02
Pick disease -1.500 5.3e-03
Pneumonia 1.200 1.5e-02
primitive neuroectodermal tumor 1.100 3.9e-02
progressive supranuclear palsy -2.100 1.6e-02
psoriasis 1.300 9.4e-06
sarcoidosis -1.300 1.5e-02
tuberculosis -1.100 2.9e-03
ulcerative colitis 1.100 3.0e-03

Gene RIF (13)

AA Sequence

MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNF      1 - 70
LLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQ     71 - 140
LLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVL    141 - 210
RGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRV    211 - 280
YIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAP    281 - 350
LSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYR    351 - 420
I//

Text Mined References (35)

PMID Year Title