Property Summary

NCBI Gene PubMed Count 29
Grant Count 9
R01 Count 9
Funding $609,238.94
PubMed Score 13.13
PubTator Score 13.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26545811 WSB1 up-regulates the expression of HIF-1alpha's target genes and promotes cancer invasion and metastasis through its effect on pVHL
26424695 Our findings show how WSB1 regulates key steps of the metastatic cascade in hypoxia-driven osteosarcoma
24441107 combination of WSB1(3) silencing together with WSB1 isoforms 1+2 silencing in NB cells showed reduced growth, enhanced apoptosis rate, and increased sensitivity to chemotherapeutic agents, specifically related to low expression of WSB1
23792163 HIF1 has a role in regulating WSB-1 expression, which promotes hypoxia-induced chemoresistance in hepatocellular carcinoma cells
20487506 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18575577 Data on WSB1 regulation support the hypothesis that activation of stress-response mechanisms helps cancer cells establishing metastases and suggest relevance to cancer development of other genes overexpressed in xenografts
18093972 the regulatory mechanisms by which HIPK2 is maintained at a low level, by WSB-1 in cells under normal conditions, and stabilized by genotoxic stresses.
16804916 WSB1 shows strong correlations between expression level and copy number, and also enhances the prognostic prediction when combined with other current prognostic factors in neuroblastoma.
15965468 WSB-1 is part of an E3 ubiquitin ligase for the thyroid-hormone-activating type 2 iodothyronine deiodinase (D2).

AA Sequence

MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNF      1 - 70
LLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQ     71 - 140
LLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVL    141 - 210
RGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRV    211 - 280
YIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAP    281 - 350
LSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYR    351 - 420
I//

Text Mined References (31)

PMID Year Title
26545811 2015 WSB1 promotes tumor metastasis by inducing pVHL degradation.
26424695 2015 Hypoxia-Induced WSB1 Promotes the Metastatic Potential of Osteosarcoma Cells.
24441107 2014 Potential role of WSB1 isoforms in growth and survival of neuroblastoma cells.
23792163 2013 HIF1 regulates WSB-1 expression to promote hypoxia-induced chemoresistance in hepatocellular carcinoma cells.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
21540461 2011 A genome-wide association study identifies novel loci associated with susceptibility to chronic myeloid leukemia.
20487506 2010 A whole genome association study of mother-to-child transmission of HIV in Malawi.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18575577 2008 The WSB1 gene is involved in pancreatic cancer progression.
More...