Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.51
PubTator Score 11.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.200 1.8e-02
atypical teratoid / rhabdoid tumor 1.100 2.9e-02
glioblastoma 1.200 6.0e-05
group 3 medulloblastoma 1.700 6.7e-03
intraductal papillary-mucinous adenoma (... 1.100 4.4e-04
medulloblastoma, large-cell 1.300 3.7e-02
Multiple myeloma 1.176 4.7e-02
oligodendroglioma 1.500 2.7e-16
osteosarcoma -1.667 1.4e-06
ovarian cancer -1.400 1.7e-06
primitive neuroectodermal tumor 1.100 4.2e-02

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTN      1 - 70
HKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENS     71 - 140
TLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRS    141 - 210
QGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGF    211 - 280
NGVSRSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRS    281 - 350
KRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYL    351 - 420
RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTV    421 - 490
TLTDEETVVKAKAYILFYVEHQAKAGSDKL                                            491 - 520
//

Text Mined References (14)

PMID Year Title