Property Summary

NCBI Gene PubMed Count 10
Grant Count 5
R01 Count 5
Funding $193,782.15
PubMed Score 12.52
PubTator Score 11.69

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.176 0.047
astrocytoma 1.600 0.000
glioblastoma 1.700 0.000
oligodendroglioma 1.500 0.000
osteosarcoma -1.667 0.000
group 3 medulloblastoma 1.800 0.013
atypical teratoid / rhabdoid tumor 1.100 0.029
medulloblastoma, large-cell 1.300 0.037
primitive neuroectodermal tumor 1.100 0.042
intraductal papillary-mucinous adenoma (... 1.100 0.000
ovarian cancer 1.900 0.000


Accession Q9Y6I4 B4DVU5 F5H1A6 Q8WVD0
Symbols UBP


Gene RIF (5)

24196443 Taken together, the results suggested that USP3 is a negative regulator of ubiquitination signaling, counteracting RNF168- and RNF8-mediated ubiquitination.
22743239 the role of UCP3 gene in functional status and survival at old age.
20445134 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17980597 Ubiquitin-specific protease 3 (USP3) is a deubiquitinating enzyme for monoubiquitinated histones H2A and H2B; USP3 dynamically associates with chromatin and deubiquitinates H2A/H2B in vivo.

AA Sequence

TLTDEETVVKAKAYILFYVEHQAKAGSDKL                                            491 - 520

Publication (13)

PMID Year Title
24196443 2014 USP3 counteracts RNF168 via deubiquitinating H2A and ?H2AX at lysine 13 and 15.
22743239 2012 UCP3 polymorphisms, hand grip performance and survival at old age: association analysis in two Danish middle aged and elderly cohorts.
20445134 2010 Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17980597 2007 Human USP3 is a chromatin modifier required for S phase progression and genome stability.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.