Property Summary

NCBI Gene PubMed Count 28
Grant Count 10
R01 Count 7
Funding $907,994.9
PubMed Score 30.44
PubTator Score 27.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 0.018

Gene RIF (10)

PMID Text
26975582 Data indicate that clathrin-mediated endocytosis of proto-oncogene protein erbB-3 (ErbB3) is depending on epsin-1.
26204806 intrinsically disordered domains are highly potent drivers of membrane curvature
25871009 Epsins are required for Dishevelled stability and Wnt signalling activation in colon cancer development.
21965661 AP-2 and epsin-1 are both required to promote efficient internalization of activated PAR1 and recognize discrete receptor sorting signals
19704019 Results show that epsin 1, an endocytic adapter protein, regulates mitotic membrane morphology and spindle integrity in HeLa cells.
19054389 epsin 1 promotes endocytosis of the ubiquitinated EGF receptor
18375383 A synthetic peptide containing the Epsin-1-(470-499) sequence could effectively block entry of HIV-1 virions into SupT1 T cells via the endocytosis pathway
18375383 A synthetic peptide containing the Epsin-1-(470-499) sequence could effectively block entry of HIV-1 virions into SupT1 T cells via the endocytosis pathway
15694383 Together, these data provide evidence that CHIP functions to ubiquitylate the endocytic protein Epsin.
12353027 An epsin 1 helix is inserted into one leaflet of the lipid bilayer, inducing curvature; on lipid monolayers epsin alone is sufficient to facilitate the formation of clathrin-coated invaginations

AA Sequence

MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKN      1 - 70
WRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRL     71 - 140
REERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEELQLQLALAMSKEEADQPPSCGPEDD    141 - 210
AQLQLALSLSREEHDKEERIRRGDDLRLQMAIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPA    211 - 280
PMAAAVPTAAPTSDPWGGPPVPPAADPWGGPAPTPASGDPWRPAAPAGPSVDPWGGTPAPAAGEGPTPDP    281 - 350
WGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAAGGFDTEPDEFSDFDRLRTALPTSGSS    351 - 420
AGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSR    421 - 490
PGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSPVPPVPGAPPTYISPLGGGPGLPP    491 - 560
MMPPGPPAPNTNPFLL                                                          561 - 576
//

Publication (41)

PMID Year Title
26975582 2016 Interaction with epsin 1 regulates the constitutive clathrin-dependent internalization of ErbB3.
26204806 2015 Intrinsically disordered proteins drive membrane curvature.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25871009 2015 Epsin is required for Dishevelled stability and Wnt signalling activation in colon cancer development.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21965661 2011 Adaptor protein complex-2 (AP-2) and epsin-1 mediate protease-activated receptor-1 internalization via phosphorylation- and ubiquitination-dependent sorting signals.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...