Property Summary

NCBI Gene PubMed Count 28
PubMed Score 32.51
PubTator Score 27.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Duodenum adenocarcinoma 4 3.516 1.8
Primary polycythemia 8 3.131 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 1.8e-02

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKN      1 - 70
WRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRL     71 - 140
REERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEELQLQLALAMSKEEADQPPSCGPEDD    141 - 210
AQLQLALSLSREEHDKEERIRRGDDLRLQMAIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPA    211 - 280
PMAAAVPTAAPTSDPWGGPPVPPAADPWGGPAPTPASGDPWRPAAPAGPSVDPWGGTPAPAAGEGPTPDP    281 - 350
WGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAAGGFDTEPDEFSDFDRLRTALPTSGSS    351 - 420
AGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSR    421 - 490
PGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSPVPPVPGAPPTYISPLGGGPGLPP    491 - 560
MMPPGPPAPNTNPFLL                                                          561 - 576
//

Text Mined References (41)

PMID Year Title