Property Summary

NCBI Gene PubMed Count 39
Grant Count 34
R01 Count 29
Funding $2,785,390.73
PubMed Score 39.30
PubTator Score 50.00

Knowledge Summary

Patent (2,750)

Expression

Gene RIF (25)

PMID Text
26718405 KCNQ1/KCNE3 channels make only a small contribution to basolateral conductance in normal colonic crypts, with increased channel activity in UC appearing insufficient to prevent colonic cell depolarization in this disease.
26668384 Data show that voltage-gated potassium channel KCNE3 directly affects the S4 movement in potassium channel KCNQ1.
26410412 KCNE1 and KCNE3: The yin and yang of voltage-gated K(+) channel regulation
22987075 A KCNE3 T4A mutation was identified in a Japanese patient presenting Brugada-pattern ECG and neurally mediated syncope.
22190306 The results of this study indicated that Kv7.5 contributes to the spatial regulation.
21899751 Allele frequencies are studied for 11 known variants of KCNE3 gene, of which two (F66F and R83H) are polymorphic but are not associated with chronic tinnitus.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20040519 2 of the 8 MiRP2 extracellular domain acidic residues (D54 and D55) are important for KCNQ1-MiRP2 constitutive activation.
20034061 data show that SNPs in KCNE1 and KCNE3 are not associated with Meniere disease in Caucasians
20034061 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAV      1 - 70
TVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI                                          71 - 103
//

Publication (38)

PMID Year Title
26718405 2016 Upregulation of basolateral small conductance potassium channels (KCNQ1/KCNE3) in ulcerative colitis.
26668384 2015 KCNE3 acts by promoting voltage sensor activation in KCNQ1.
26410412 2016 KCNE1 and KCNE3: The yin and yang of voltage-gated K(+) channel regulation.
22987075 2012 KCNE3 T4A as the genetic basis of Brugada-pattern electrocardiogram.
22190306 2012 Targeting of Kv7.5 (KCNQ5)/KCNE channels to surface microdomains of cell membranes.
22144915 2011 Genome-wide meta-analysis of five Asian cohorts identifies PDGFRA as a susceptibility locus for corneal astigmatism.
21899751 2011 Deep resequencing of the voltage-gated potassium channel subunit KCNE3 gene in chronic tinnitus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20533308 2010 Impact of KCNE subunits on KCNQ1 (Kv7.1) channel membrane surface targeting.
20040519 2010 A shared mechanism for lipid- and beta-subunit-coordinated stabilization of the activated K+ channel voltage sensor.
More...