Property Summary

NCBI Gene PubMed Count 42
PubMed Score 41.38
PubTator Score 50.00

Knowledge Summary

Patent (2,750)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Brugada Syndrome 6 1 0.0 0.0
Disease Target Count Z-score Confidence
Refractive error 50 0.0 1.0
Disease Target Count
Brugada syndrome 29

Expression

Gene RIF (28)

AA Sequence

METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAV      1 - 70
TVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI                                          71 - 103
//

Text Mined References (41)

PMID Year Title