Property Summary

NCBI Gene PubMed Count 73
Grant Count 69
R01 Count 29
Funding $7,147,335.33
PubMed Score 114.76
PubTator Score 32.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.600 0.000
posterior fossa group B ependymoma 2.700 0.000
oligodendroglioma 2.100 0.008
glioblastoma multiforme 1.100 0.000
osteosarcoma 1.785 0.003
group 4 medulloblastoma 2.900 0.000
primitive neuroectodermal tumor 1.700 0.019
colon cancer -1.800 0.026
lung cancer -2.900 0.000
Breast cancer -2.800 0.042
interstitial cystitis 2.300 0.000
pilocytic astrocytoma -1.300 0.000
lung carcinoma 1.200 0.000
ovarian cancer -3.600 0.000
pituitary cancer -1.400 0.000

Synonym

Gene

PDB

2KES  

Gene RIF (39)

PMID Text
26465922 Differential expression of synphilin-1 isoforms (and alpha-synuclein and parkin) was found in multiple system atrophy brains compared to control brain.
25545246 Synphilin-1 binds ATP, but not CTP.
24829096 Overexpression of human synphilin-1 in mice resulted in hyperphagia and obesity.
22828940 Overexpression of SP1 in neurons, but not peripheral cells, increased the body weight of flies compared with that of non-transgenic controls. SP1 increased food intake but did not affect locomotor activity
21344240 Mutation screening of SNCAIP identifies novel sequence variants using a bioinformatic approach; further studies are necessary to determine their possible functional consequences in South African patients with Parkinson's disease.
21103907 Synphilin-1 inhibits alpha-synuclein degradation by the proteasome.
20849899 Although serine-129 phosphorylation of alpha-synuclein facilitates tubulin polymerization promoting protein (TPPP)-mediated alpha-SYN oligomerization, this modification does not seem to play an inevitable role in the early step of alpha-SYN oligomer formation.
20816781 Neuronal survival factor MEF2D is decreased in human and experimental Parkinson's disease, a decrease that is specifically associated with alpha-synuclein accumulation and aggregation.
20604806 Knockdown of Herp gene unexpectedly facilitated the degradation of synphilin-1, and improved cell viability during proteasomal inhibition.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MEAPEYLDLDEIDFSDDISYSVTSLKTIPELCRRCDTQNEDRSVSSSSWNCGISTLITNTQKPTGIADVY      1 - 70
SKFRPVKRVSPLKHQPETLENNESDDQKNQKVVEYQKGGESDLGPQPQELGPGDGVGGPPGKSSEPSTSL     71 - 140
GELEHYDLDMDEILDVPYIKSSQQLASFTKVTSEKRILGLCTTINGLSGKACSTGSSESSSSNMAPFCVL    141 - 210
SPVKSPHLRKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQL    211 - 280
RAFHLQSSAAESKPEEQVSGLNRTSSQGPEERSEYLKKVKSILNIVKEGQISLLPHLAADNLDKIHDENG    281 - 350
NNLLHIAASQGHAECLQHLTSLMGEDCLNERNTEKLTPAGLAIKNGQLECVRWMVSETEAIAELSCSKDF    351 - 420
PSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDQDGNSAVHVASQHGYLGCIQTLVEYGANVTMQNHAG    421 - 490
EKPSQSAERQGHTLCSRYLVVVETCMSLASQVVKLTKQLKEQTVERVTLQNQLQQFLEAQKSEGKSLPSS    491 - 560
PSSPSSPASRKSQWKSPDADDDSVAKSKPGVQEGIQVLGSLSASSRARPKAKDEDSDKILRQLLGKEISE    561 - 630
NVCTQEKLSLEFQDAQASSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKTTPVRKADRPR    631 - 700
PQPIVESVESMDSAESLHLMIKKHTLASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGSGSIP    701 - 770
PNQPSGDPQQPSPDSTAAQKVATSPKSALKSPSSKRRTSQNLKLRVTFEEPVVQMEQPSLELNGEKDKDK    771 - 840
GRTLQRTSTSNESGDQLKRPFGAFRSIMETLSGNQNNNNNYQAANQLKTSTLPLTSLGRKTDAKGNPASS    841 - 910
ASKGKNKAA                                                                 911 - 919
//

Text Mined References (74)

PMID Year Title
26465922 2016 Altered ?-synuclein, parkin, and synphilin isoform levels in multiple system atrophy brains.
25811964 2015 Derivatives containing both coumarin and benzimidazole potently induce caspase-dependent apoptosis of cancer cells through inhibition of PI3K-AKT-mTOR signaling.
25545246 2014 Synphilin-1 binds ATP and regulates intracellular energy status.
25484190 2014 Autophagy modulates SNCA/?-synuclein release, thereby generating a hostile microenvironment.
25124556 2014 GRP78 clustering at the cell surface of neurons transduces the action of exogenous alpha-synuclein.
24980887 2014 Genome-wide DNA methylation study identifies significant epigenomic changes in osteoarthritic cartilage.
24902662 2015 Synphilin-1A is a phosphoprotein phosphatase 1-interacting protein and affects PPP1 sorting to subcellular compartments.
24829096 2014 Behavioral characterization of the hyperphagia synphilin-1 overexpressing mice.
24064336 2014 Overexpression of synphilin-1 promotes clearance of soluble and misfolded alpha-synuclein without restoring the motor phenotype in aged A30P transgenic mice.
23964651 2013 A molecular dynamics simulation-based interpretation of nuclear magnetic resonance multidimensional heteronuclear spectra of ?-synuclein·dopamine adducts.
More...