Property Summary

NCBI Gene PubMed Count 73
PubMed Score 92.09
PubTator Score 32.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
PARKINSON DISEASE, LATE-ONSET 20 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Melanoma 711 0.0 0.7
Skin cancer 469 0.0 0.6
Disease Target Count Z-score Confidence
Parkinson's disease 392 5.53 2.8
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.300 3.5e-02
Astrocytoma, Pilocytic -1.300 6.1e-04
Breast cancer -2.800 4.2e-02
colon cancer -1.800 2.6e-02
ependymoma 2.300 5.6e-03
glioblastoma multiforme 1.100 3.3e-15
group 3 medulloblastoma 2.000 2.6e-02
interstitial cystitis 1.200 2.6e-03
lung cancer -2.700 1.4e-04
lung carcinoma 1.200 5.1e-07
oligodendroglioma 2.100 8.1e-03
osteosarcoma 1.785 2.6e-03
ovarian cancer -3.600 3.5e-16
pituitary cancer -1.400 2.0e-04
primitive neuroectodermal tumor 1.700 1.9e-02

Gene RIF (39)

AA Sequence

MEAPEYLDLDEIDFSDDISYSVTSLKTIPELCRRCDTQNEDRSVSSSSWNCGISTLITNTQKPTGIADVY      1 - 70
SKFRPVKRVSPLKHQPETLENNESDDQKNQKVVEYQKGGESDLGPQPQELGPGDGVGGPPGKSSEPSTSL     71 - 140
GELEHYDLDMDEILDVPYIKSSQQLASFTKVTSEKRILGLCTTINGLSGKACSTGSSESSSSNMAPFCVL    141 - 210
SPVKSPHLRKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQL    211 - 280
RAFHLQSSAAESKPEEQVSGLNRTSSQGPEERSEYLKKVKSILNIVKEGQISLLPHLAADNLDKIHDENG    281 - 350
NNLLHIAASQGHAECLQHLTSLMGEDCLNERNTEKLTPAGLAIKNGQLECVRWMVSETEAIAELSCSKDF    351 - 420
PSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDQDGNSAVHVASQHGYLGCIQTLVEYGANVTMQNHAG    421 - 490
EKPSQSAERQGHTLCSRYLVVVETCMSLASQVVKLTKQLKEQTVERVTLQNQLQQFLEAQKSEGKSLPSS    491 - 560
PSSPSSPASRKSQWKSPDADDDSVAKSKPGVQEGIQVLGSLSASSRARPKAKDEDSDKILRQLLGKEISE    561 - 630
NVCTQEKLSLEFQDAQASSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKTTPVRKADRPR    631 - 700
PQPIVESVESMDSAESLHLMIKKHTLASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGSGSIP    701 - 770
PNQPSGDPQQPSPDSTAAQKVATSPKSALKSPSSKRRTSQNLKLRVTFEEPVVQMEQPSLELNGEKDKDK    771 - 840
GRTLQRTSTSNESGDQLKRPFGAFRSIMETLSGNQNNNNNYQAANQLKTSTLPLTSLGRKTDAKGNPASS    841 - 910
ASKGKNKAA                                                                 911 - 919
//

Text Mined References (74)

PMID Year Title