Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.69
PubTator Score 5.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 5.01557311087701E-8
ovarian cancer 8492 0.0014834485264973
osteosarcoma 7933 0.0130385366090211
astrocytic glioma 2241 0.0154842808642415
oligodendroglioma 2849 0.0175762442181958
adrenocortical carcinoma 1427 0.0237408863221096
adult high grade glioma 2148 0.0318029928417412
ependymoma 2514 0.0388619709811591

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.700 0.015
ependymoma -1.600 0.039
oligodendroglioma -1.700 0.018
osteosarcoma -1.861 0.013
adrenocortical carcinoma 1.018 0.024
ulcerative colitis -1.900 0.000
adult high grade glioma 1.400 0.032
ovarian cancer 1.100 0.001

Synonym

Accession Q9Y6H3 Q1RLM4 Q96E81
Symbols KUB3
XRCC6BP1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (1)

PMID Text
23670597 The data provide the first evidence for a link between the level of KUB3 amplification and expression in glioma and DSB repair efficiency.

AA Sequence

MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLL      1 - 70
DAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDW     71 - 140
FTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFE    141 - 210
SCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI                                      211 - 246
//

Text Mined References (8)

PMID Year Title
23670597 2013 Glioma-amplified sequence KUB3 influences double-strand break repair after ionizing radiation.
17135290 2007 The metalloprotease encoded by ATP23 has a dual function in processing and assembly of subunit 6 of mitochondrial ATPase.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11571779 2001 KUB3 amplification and overexpression in human gliomas.
10219089 1999 Isolation of Ku70-binding proteins (KUBs).