Property Summary

NCBI Gene PubMed Count 32
PubMed Score 39.81
PubTator Score 21.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
PARKINSON DISEASE 22, AUTOSOMAL DOMINANT 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 4.6e-18
Breast cancer 3578 3.7e-04
osteosarcoma 7950 1.4e-03
oligodendroglioma 2850 7.7e-03
medulloblastoma, large-cell 6241 2.4e-02
ependymoma 4679 2.7e-02
Disease Target Count Z-score Confidence
Parkinson's disease 392 4.679 2.3
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Essential tremor 28 3.012 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.100 3.7e-04
ependymoma 1.100 2.7e-02
medulloblastoma, large-cell -1.200 2.4e-02
oligodendroglioma 1.400 7.7e-03
osteosarcoma 1.628 1.4e-03
ovarian cancer -1.600 4.6e-18

Gene RIF (22)

AA Sequence

MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGS      1 - 70
AVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEV     71 - 140
LKQCRLANGLA                                                               141 - 151
//

Text Mined References (35)

PMID Year Title