Property Summary

NCBI Gene PubMed Count 23
Grant Count 1
Funding $72,824.5
PubMed Score 44.69
PubTator Score 30.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma -1.400 0.015
ependymoma -1.200 0.045
osteosarcoma -1.359 0.000
atypical teratoid / rhabdoid tumor -1.100 0.001
glioblastoma -1.200 0.000
Amyotrophic Lateral Sclerosis 1.073 0.000
Breast cancer 2.200 0.040
adult high grade glioma -1.200 0.001
subependymal giant cell astrocytoma -1.026 0.033
invasive ductal carcinoma 1.300 0.026
ovarian cancer 1.300 0.004

Synonym

Accession Q9Y6G9 A2RRG7 Q53HC8 Q53HK7 LIC1
Symbols LIC1
DLC-A
DNCLI1

Gene

 Grant Application (1)

Protein-protein Interaction (8)

Gene RIF (6)

PMID Text
25422374 although dynein lacking light intermediate chains (LICs) drives microtubule gliding at normal rates, the LICs are required for the formation and maintenance of a bipolar spindle.
25231297 HIV-1 CA uncoating is delayed in the presence of ciliobrevin D, a specific inhibitor of dynein-mediated motor function, indicating that dynein is involved in CA uncoating in cells
22190034 HIV-1 CA uncoating is delayed in the presence of ciliobrevin D, a specific inhibitor of dynein-mediated motor function, indicating that dynein is involved in CA uncoating in cells
21169557 using a variety of complementary approaches, our results indicate a novel specific role for the LICs in dynein recruitment to components of the late endocytic pathway.
20026645 Rab11a, FIP3 and DLIC-1 form a ternary complex and DLIC-1 colocalises with endogenous FIP3 and Rab11a in A431 cells.
19229290 Dynein light intermediate chain 1 is required for progress through the spindle assembly checkpoint

AA Sequence

MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRSRSKLPAGKNV      1 - 70
LLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVWILDGDLYHKGLLKFSLDAVS     71 - 140
LKDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQR    141 - 210
RNTASQEDKDDSVVLPLGADTLTHNLGIPVLVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGA    211 - 280
ALIYTSVKENKNIDLVYKYIVQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFE    281 - 350
DIITKPPVRKFVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASV    351 - 420
SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVSGGSPAGGAGGGSSGLPPSTKKSGQK    421 - 490
PVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS                                         491 - 523
//

Publication (38)

PMID Year Title
27482052 2016 Assembly and activation of dynein-dynactin by the cargo adaptor protein Hook3.
25422374 2014 Dynein light intermediate chains maintain spindle bipolarity by functioning in centriole cohesion.
25416956 2014 A proteome-scale map of the human interactome network.
25272277 2014 A Ras-like domain in the light intermediate chain bridges the dynein motor to a cargo-binding region.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
More...