Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.20
PubTator Score 0.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.300 0.000
psoriasis 1.200 0.000
osteosarcoma 1.252 0.030
posterior fossa group B ependymoma 1.400 0.000
glioblastoma 1.900 0.000
group 3 medulloblastoma 1.900 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.400 0.000
non-small cell lung cancer 1.301 0.000
lung cancer 2.200 0.002
Breast cancer -2.000 0.045
pediatric high grade glioma 1.300 0.000
lung carcinoma 1.100 0.000
invasive ductal carcinoma 1.500 0.000

Synonym

Accession Q9Y6G3 Q6FID1 Q96Q48 Q9P0S1 L42mt
Symbols L31MT
L42MT
S32MT
MRPL31
MRPS32
PTD007
RPML31
HSPC204
MRP-L31
MRP-L42
MRP-S32

Gene

PDB

3J9M   3J7Y  

Gene RIF (4)

PMID Text
26107902 MPO and BPI in CD4(+)T-lymphocytes, and PDHA1 and MRPL42 in CD8(+) T-lymphocytes might be used as specific biomarkers of severe asthma progression.
22190034 HIV-1 Rev is identified to have a physical interaction with mitochondrial ribosomal protein L42 (MRPL42) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYE      1 - 70
HTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPK     71 - 140
DR                                                                        141 - 142
//

Text Mined References (22)

PMID Year Title
26107902 [Comparative analysis of the role of CD4(+) and CD8(+) T cells in severe asthma development].
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...