Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.05
PubTator Score 1.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 7.09059142001176E-22
non-small cell lung cancer 2798 5.76056064991149E-14
atypical teratoid / rhabdoid tumor 4369 1.43629356532033E-7
pituitary cancer 1972 2.33370202538286E-7
malignant mesothelioma 3163 6.60893223885982E-7
medulloblastoma, large-cell 6234 2.30818056274751E-6
glioblastoma 5572 5.91537084903481E-6
ovarian cancer 8492 1.48415491007404E-4
Pick disease 1893 3.50656382473593E-4
adult high grade glioma 2148 7.65455396784789E-4
medulloblastoma 1524 0.00112189743281568
Multiple myeloma 1328 0.00127179473526504
lung cancer 4473 0.00230351152467425
osteosarcoma 7933 0.00547286157613771
astrocytic glioma 2241 0.0347833980662373
ependymoma 2514 0.0368849210421196
acute myeloid leukemia 785 0.0469398980724337

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.901 0.001
malignant mesothelioma -1.900 0.000
astrocytic glioma -1.500 0.035
ependymoma -1.700 0.037
osteosarcoma 1.534 0.005
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.300 0.000
medulloblastoma -1.200 0.001
medulloblastoma, large-cell -2.300 0.000
non-small cell lung cancer 1.355 0.000
lung cancer 2.000 0.002
adult high grade glioma -1.300 0.001
lung carcinoma 1.400 0.000
Pick disease -1.500 0.000
acute myeloid leukemia -1.800 0.047
ovarian cancer -1.700 0.000
pituitary cancer 1.500 0.000

Synonym

Accession Q9Y6G1 B2R552
Symbols PTD011
C6orf73

Gene

PDB

2LOO   2LOP  

  Ortholog (12)

Gene RIF (2)

PMID Text
26896463 these results indicate that TMEM14A has a pro-tumorigenic effect in ovarian cancer cells, suggesting an important role of this protein in ovarian cancer oncogenesis and metastasis.
21723035 findings show for the first time that TMEM14A inhibits apoptosis by blocking the mitochondrial permeability transition and stabilizing mitochondrial membrane potential

AA Sequence

MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVR      1 - 70
FKRSKKIMPAGLVAGLSLMMILRLVLLLL                                              71 - 99
//

Text Mined References (10)

PMID Year Title
26896463 2016 Knockdown of TMEM14A expression by RNAi inhibits the proliferation and invasion of human ovarian cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
22609626 2012 Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
21723035 2011 TMEM14A inhibits N-(4-hydroxyphenyl)retinamide-induced apoptosis through the stabilization of mitochondrial membrane potential.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.