Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.05
PubTator Score 1.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute myeloid leukemia -1.800 4.7e-02
adult high grade glioma -1.300 7.7e-04
astrocytic glioma -1.500 3.5e-02
atypical teratoid / rhabdoid tumor -1.300 1.4e-07
ependymoma -1.700 3.7e-02
glioblastoma -1.300 5.9e-06
group 4 medulloblastoma -1.200 2.7e-04
lung cancer 2.000 2.3e-03
lung carcinoma 1.400 7.1e-22
malignant mesothelioma -1.900 6.6e-07
medulloblastoma, large-cell -2.300 2.3e-06
Multiple myeloma 1.901 1.3e-03
non-small cell lung cancer 1.355 5.8e-14
osteosarcoma 1.534 5.5e-03
ovarian cancer -1.700 1.5e-04
Pick disease -1.500 3.5e-04
pituitary cancer 1.500 2.3e-07

Gene RIF (2)

AA Sequence

MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVR      1 - 70
FKRSKKIMPAGLVAGLSLMMILRLVLLLL                                              71 - 99
//

Text Mined References (10)

PMID Year Title