Property Summary

NCBI Gene PubMed Count 19
PubMed Score 46.62
PubTator Score 23.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.9e-22
breast carcinoma 1638 8.3e-05

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.300 8.3e-05
psoriasis -1.300 5.9e-22

 GO Function (1)

Gene RIF (8)

AA Sequence

MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGAR      1 - 70
LGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGR     71 - 140
APPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAG    141 - 210
RLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPG    211 - 280
RADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVV    281 - 350
QCHRCRVRKELSLCL                                                           351 - 365
//

Text Mined References (19)

PMID Year Title