Property Summary

NCBI Gene PubMed Count 21
Grant Count 11
R01 Count 10
Funding $931,709.19
PubMed Score 18.52
PubTator Score 23.43

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (7)

PMID Text
25042452 Findings showed that deletion of CDY1b copy gene is a significant risk factor for male infertility independent of sperm concentration, whereas deletion of CDY1a gene seems to have no effect on fertility in the Tunisian population.
21474125 Assessing the expression of both CDY1 and BOULE by qualitative RT-PCR is a sensitive and feasible test for predicting the presence of sperm cells in testicular tissue biopsies.
20663794 Observational study of gene-disease association. (HuGE Navigator)
20039973 Observational study of gene-disease association. (HuGE Navigator)
18807255 Partial AZFc deletions including CDY1-DAZ gene is associated with impaired spermatogenesis.
18326516 Observational study of gene-disease association. (HuGE Navigator)
14569460 different functional roles for CDY isoforms during spermatogenesis

AA Sequence

MASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTEKQKKLTWTTT      1 - 70
SRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNRKLFAASKNVRRKAASILSDTKNMEIINSTIE     71 - 140
TLAPDSPFDHKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSRPGAEQTGIQNKTQIHPLMSQM    141 - 210
SGSVTASMATGSATRKGIVVLIDPLAANGTTDMHTSVPRVKGGQRNITDDSRDQPFIKKMHFTIRLTESA    211 - 280
STYRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEIVNALNSAAADDSKLVLFSAAGSVFCCGLDFGYF    281 - 350
VKHLRNNRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTF    351 - 420
GQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNPIVL    421 - 490
EECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF                        491 - 540
//

Text Mined References (22)

PMID Year Title
25042452 2014 Deletion of CDY1b copy of Y chromosome CDY1 gene is a risk factor of male infertility in Tunisian men.
21474125 2011 CDY1 and BOULE transcripts assessed in the same biopsy as predictive markers for successful testicular sperm retrieval.
20663794 2010 Features of constitutive gr/gr deletion in a Japanese population.
20039973 2010 Differential effect of specific gr/gr deletion subtypes on spermatogenesis in the Chinese Han population.
19507244 2009 Crystal structures of human CDY proteins reveal a crotonase-like fold.
18807255 2008 Partial AZFc deletions and duplications: clinical correlates in the Italian population.
18450745 2008 Specificity of the chromodomain Y chromosome family of chromodomains for lysine-methylated ARK(S/T) motifs.
18326516 2008 Do we need to search for gr/gr deletions in infertile men in a clinical setting?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14569460 2003 Members of the CDY family have different expression patterns: CDY1 transcripts have the best correlation with complete spermatogenesis.
More...