Property Summary

NCBI Gene PubMed Count 21
PubMed Score 18.64
PubTator Score 23.43

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (7)

AA Sequence

MASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTEKQKKLTWTTT      1 - 70
SRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNRKLFAASKNVRRKAASILSDTKNMEIINSTIE     71 - 140
TLAPDSPFDHKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSRPGAEQTGIQNKTQIHPLMSQM    141 - 210
SGSVTASMATGSATRKGIVVLIDPLAANGTTDMHTSVPRVKGGQRNITDDSRDQPFIKKMHFTIRLTESA    211 - 280
STYRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEIVNALNSAAADDSKLVLFSAAGSVFCCGLDFGYF    281 - 350
VKHLRNNRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTF    351 - 420
GQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNPIVL    421 - 490
EECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF                        491 - 540
//

Text Mined References (22)

PMID Year Title