Property Summary

NCBI Gene PubMed Count 21
Grant Count 3
Funding $131,331
PubMed Score 25.55
PubTator Score 15.69

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y6F6 B7Z3T4 B7Z6I2 B7Z9A3 E9PQY6 F5H6A1 J3KQZ7 Q17S00 Q9UNY1
Symbols IRAG
JAW1L

Gene

PANTHER Protein Class (1)

Gene RIF (9)

PMID Text
21865585 In the present study we analyzed the structure and function of the human IRAG/MRVI1 gene
20567233 IRAG is required for PKG1beta-regulated cyclic calcium release during motility of osteoclasts
20526338 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
16990611 These findings reveal that interaction between IRAG and InsP3RI has a central role in NO/cGMP-dependent inhibition of platelet aggregation and in vivo thrombosis.
16166082 cGMP-dependent protein kinase Ibeta binds to TFII-I and IRAG through a common interaction motif
14729908 IRAG appears to be essentially involved in the NO/cGK-dependent inhibition of InsP(3)-dependent Ca(2+)-signaling in colonic smooth muscle
10321731 Reports use of non-AUG (CUG) translation initiation codon in one of the transcript variants of MRVI1 gene in mouse and human.

AA Sequence

MGMDLTCPFGISPACGAQASWSIFGADAAEVPGTRGHSQQEAAMPHIPEDEEPPGEPQAAQSPAGQGPPA      1 - 70
AGVSCSPTPTIVLTGDATSPEGETDKNLANRVHSPHKRLSHRHLKVSTASLTSVDPAGHIIDLVNDQLPD     71 - 140
ISISEEDKKKNLALLEEAKLVSERFLTRRGRKSRSSPGDSPSAVSPNLSPSASPTSSRSNSLTVPTPPDG    141 - 210
DEADVSSPHPGEPNVPKGLADRKQNDQRKVSQGRLAPRPPPVEKSKEIAIEQKENFDPLQYPETTPKGLA    211 - 280
PVTNSSGKMALNSPQPGPVESELGKQLLKTGWEGSPLPRSPTQDAAGVGPPASQGRGPAGEPMGPEAGSK    281 - 350
AELPPTVSRPPLLRGLSWDSGPEEPGPRLQKVLAKLPLAEEEKRFAGKAGGKLAKAPGLKDFQIQVQPVR    351 - 420
MQKLTKLREEHILMRNQNLVGLKLPDLSEAAEQEKGLPSELSPAIEEEESKSGLDVMPNISDVLLRKLRV    421 - 490
HRSLPGSAPPLTEKEVENVFVQLSLAFRNDSYTLESRINQAERERNLTEENTEKELENFKASITSSASLW    491 - 560
HHCEHRETYQKLLEDIAVLHRLAARLSSRAEVVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEF    561 - 630
KKLANQNSSRSCGPSEDGVPRTARSMSLTLGKNMPRRRVSVAVVPKFNALNLPGQTPSSSSIPSLPALSE    631 - 700
SPNGKGSLPVTSALPALLENGKTNGDPDCEASAPALTLSCLEELSQETKARMEEEAYSKGFQEGLKKTKE    701 - 770
LQDLKEEEEEQKSESPEEPEEVEETEEEEKGPRSSKLEELVHFLQVMYPKLCQHWQVIWMMAAVMLVLTV    771 - 840
VLGLYNSYNSCAEQADGPLGRSTCSAAQRDSWWSSGLQHEQPTEQ                             841 - 885
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
21865585 2011 Truncated IRAG variants modulate cGMP-mediated inhibition of human colonic smooth muscle cell contraction.
21244222 2011 Signaling via IRAG is essential for NO/cGMP-dependent inhibition of platelet activation.
20969748 2010 Identification of differentially expressed genes using an annealing control primer system in stage III serous ovarian carcinoma.
20567233 2010 Functional osteoclast attachment requires inositol-1,4,5-trisphosphate receptor-associated cGMP-dependent kinase substrate.
20526338 2010 Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...