Property Summary

NCBI Gene PubMed Count 21
PubMed Score 26.15
PubTator Score 15.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.700 8.4e-05
astrocytic glioma 1.200 1.6e-02
Astrocytoma, Pilocytic -1.600 2.9e-06
atypical teratoid / rhabdoid tumor -2.400 7.8e-10
axial spondyloarthropathy 2.200 4.8e-04
cystic fibrosis -1.161 6.7e-05
ependymoma -1.200 7.2e-05
glioblastoma -1.600 3.5e-09
group 3 medulloblastoma -2.000 2.1e-04
interstitial lung disease 1.500 1.4e-02
intraductal papillary-mucinous adenoma (... -1.800 1.0e-04
intraductal papillary-mucinous carcinoma... -2.200 5.0e-04
intraductal papillary-mucinous neoplasm ... -2.200 6.9e-04
invasive ductal carcinoma -1.100 1.1e-02
medulloblastoma, large-cell -2.100 7.3e-05
oligodendroglioma 1.500 1.6e-02
osteosarcoma -2.437 2.6e-03
ovarian cancer 1.800 3.5e-04
pancreatic cancer 1.700 5.2e-03
Pick disease 1.500 3.8e-02
primary pancreatic ductal adenocarcinoma 1.555 3.0e-03
primitive neuroectodermal tumor -2.200 1.3e-05
Rheumatoid arthritis 2.100 3.2e-03

Protein-protein Interaction (9)

Gene RIF (9)

AA Sequence

MGMDLTCPFGISPACGAQASWSIFGADAAEVPGTRGHSQQEAAMPHIPEDEEPPGEPQAAQSPAGQGPPA      1 - 70
AGVSCSPTPTIVLTGDATSPEGETDKNLANRVHSPHKRLSHRHLKVSTASLTSVDPAGHIIDLVNDQLPD     71 - 140
ISISEEDKKKNLALLEEAKLVSERFLTRRGRKSRSSPGDSPSAVSPNLSPSASPTSSRSNSLTVPTPPDG    141 - 210
DEADVSSPHPGEPNVPKGLADRKQNDQRKVSQGRLAPRPPPVEKSKEIAIEQKENFDPLQYPETTPKGLA    211 - 280
PVTNSSGKMALNSPQPGPVESELGKQLLKTGWEGSPLPRSPTQDAAGVGPPASQGRGPAGEPMGPEAGSK    281 - 350
AELPPTVSRPPLLRGLSWDSGPEEPGPRLQKVLAKLPLAEEEKRFAGKAGGKLAKAPGLKDFQIQVQPVR    351 - 420
MQKLTKLREEHILMRNQNLVGLKLPDLSEAAEQEKGLPSELSPAIEEEESKSGLDVMPNISDVLLRKLRV    421 - 490
HRSLPGSAPPLTEKEVENVFVQLSLAFRNDSYTLESRINQAERERNLTEENTEKELENFKASITSSASLW    491 - 560
HHCEHRETYQKLLEDIAVLHRLAARLSSRAEVVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEF    561 - 630
KKLANQNSSRSCGPSEDGVPRTARSMSLTLGKNMPRRRVSVAVVPKFNALNLPGQTPSSSSIPSLPALSE    631 - 700
SPNGKGSLPVTSALPALLENGKTNGDPDCEASAPALTLSCLEELSQETKARMEEEAYSKGFQEGLKKTKE    701 - 770
LQDLKEEEEEQKSESPEEPEEVEETEEEEKGPRSSKLEELVHFLQVMYPKLCQHWQVIWMMAAVMLVLTV    771 - 840
VLGLYNSYNSCAEQADGPLGRSTCSAAQRDSWWSSGLQHEQPTEQ                             841 - 885
//

Text Mined References (25)

PMID Year Title