Property Summary

Ligand Count 13
NCBI Gene PubMed Count 24
PubMed Score 41.92
PubTator Score 21.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer -1.200 2.3e-05
psoriasis 1.100 6.4e-04

Gene RIF (16)

AA Sequence

MAPKPKPWVQTEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGTQVYEDYNCTL      1 - 70
NQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQSKINHFTRLEDAKKDFEKKFREKTKNNWAER     71 - 140
DHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRVQPCSLDPATQKLITNIFSKEMFKNTMALMD    141 - 210
LDVKKMPLGKLSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQ    211 - 280
AKKDMLLVLADIELAQALQAVSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNH    281 - 350
RCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENS    351 - 420
KSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQ    421 - 490
QVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL                               491 - 533
//

Text Mined References (27)

PMID Year Title