Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
R01 Count 5
Funding $793,988
PubMed Score 37.29
PubTator Score 21.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 0.001
inflammatory breast cancer -1.200 0.000

Synonym

Accession Q9Y6F1 Q8NER9 Q96CG2 Q9UG81 PARP-3
Symbols IRT1
ARTD3
ADPRT3
ADPRTL2
ADPRTL3
PADPRT-3

Gene

PDB

2EOC   3C49   3C4H   3CE0   3FHB   4GV0   4GV2   4GV4   4L6Z   4L70   4L7L   4L7N   4L7O   4L7P   4L7R   4L7U  

Gene RIF (14)

PMID Text
26040766 we found that PARP3 interacted with FoxM1 to enhance its transcriptional activity and conferred glioblastoma cell radioresistance. Thus, our data suggest that PARP3 could be a therapeutic target to overcome radioresistance in glioblastoma
25800440 Identification of ADP-ribosylation sites in PARP3 and the determination of the extent ofpoly(ADP-ribosyl)ated residues in this protein was performed.
25255219 MiR-630 reduced apoptosis by downregulating several apoptotic modulators, PARP3, DDIT4, and EP300.
24598253 PARP3 likely facilitates the recruitment of Ku80 to double strand breaks to antagonize DNA end resection but facilitate Ku-mediated accurate classical non-homologous end-joining.
24528514 In some cancer cells, repression of PARP3 could be responsible for an increased telomerase activity.
21270334 PARP3 is a critical player in the stabilization of the mitotic spindle and in telomere integrity by associating and regulating the mitotic components NuMA and tankyrase 1.
21264220 PARP3 gene occupancy in the human neuroblastoma cell line SK-N-SH occurs preferentially with developmental genes regulating cell fate specification, tissue patterning, craniofacial development and neurogenesis.
21211721 PARP-3 has a role in chromosomal DNA double-strand break repair.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20064938 the interaction between PARP-1 and PARP-3 is unrelated to DNA single-strand break repair
More...

AA Sequence

MAPKPKPWVQTEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGTQVYEDYNCTL      1 - 70
NQTNIENNNNKFYIIQLLQDSNRFFTCWNHWGRVGEVGQSKINHFTRLEDAKKDFEKKFREKTKNNWAER     71 - 140
DHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRVQPCSLDPATQKLITNIFSKEMFKNTMALMD    141 - 210
LDVKKMPLGKLSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQ    211 - 280
AKKDMLLVLADIELAQALQAVSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNH    281 - 350
RCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENS    351 - 420
KSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQ    421 - 490
QVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL                               491 - 533
//

Text Mined References (25)

PMID Year Title
26040766 2015 PARP3 interacts with FoxM1 to confer glioblastoma cell radioresistance.
25800440 2015 Quantitative site-specific ADP-ribosylation profiling of DNA-dependent PARPs.
25255219 2014 MiR-630 inhibits proliferation by targeting CDC7 kinase, but maintains the apoptotic balance by targeting multiple modulators in human lung cancer A549 cells.
24598253 2014 PARP3 affects the relative contribution of homologous recombination and nonhomologous end-joining pathways.
24528514 2014 Poly (ADP-ribose) polymerase 3 (PARP3), a potential repressor of telomerase activity.
21270334 2011 Poly(ADP-ribose) polymerase 3 (PARP3), a newcomer in cellular response to DNA damage and mitotic progression.
21264220 2011 A key role for poly(ADP-ribose) polymerase 3 in ectodermal specification and neural crest development.
21211721 2011 PARP-3 and APLF function together to accelerate nonhomologous end-joining.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
More...