Property Summary

NCBI Gene PubMed Count 35
PubMed Score 133.91
PubTator Score 32.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cardiomegaly 116 0.0 0.0
Endomyocardial Fibrosis 13 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 6.5e-04
gastric carcinoma 807 1.1e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.408 1.7
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.539 1.8
Obesity 678 3.095 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
gastric carcinoma -1.200 1.1e-02
osteosarcoma -1.070 6.5e-04

Protein-protein Interaction (2)

Gene RIF (23)

AA Sequence

MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESG      1 - 70
IPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWL     71 - 140
VTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEE    141 - 210
QVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKL    211 - 280
PIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC                                        281 - 314
//

Text Mined References (37)

PMID Year Title