Property Summary

NCBI Gene PubMed Count 29
PubMed Score 115.12
PubTator Score 32.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 6.47818518099887E-4
gastric carcinoma 832 0.0112523882782761
Disease Target Count Z-score Confidence
Cancer 2346 3.31 1.7
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.453 1.7
Obesity 616 3.054 1.5
Metabolic syndrome X 155 3.051 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.070 0.001
gastric carcinoma -1.200 0.011

Synonym

Accession Q9Y6E7 O43346 Q32M33
Symbols SIR2L4

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly OMA EggNOG Inparanoid

Gene RIF (17)

PMID Text
26775843 Thus, these results suggest that SIRT4 has essential roles in stress resistance and may be an important therapeutic target for cancer treatment.
26086877 SIRT4 has a tumour-suppressive function and may serve as a novel therapeutic target in colorectal cancer.
26054687 SIRT4 behaves as a tumor suppressor at the human tissue protein level.
25633289 C-terminal-binding protein (CtBP) was found to have an essential role in promoting glutaminolysis by directly repressing the expression of SIRT4.
25525879 Until now, a mammalian cellular lipoamidase has not been characterized; this study discovered that SIRT4 can function with this enzymatic capacity in the mitochondria, and that PDH is a biological substrate; compared to its catalytic efficiency for deacetylation, SIRT4 exhibits far superior enzymatic activity for lipoyl- and biotinyl-lysine modifications.
25466907 Serum Sirt4 was inversely related to anthropometric and metabolic parameters and positively related to peak GH and IGF-1.
25361925 This study demonstrated that SIRT4 upregulation in the liver of non-alcoholic fatty liver disease patients.
25331589 Overexpression of SIRT4 attenuated inflammation mediators in umbilical vein endothelial cells.
25165814 Results show that mitochondrial sirtuins SIRT3, SIRT4, and SIRT5 can promote increased mitochondrial respiration and cellular metabolism and respond to excess glucose by inducing a coordinated increase of glycolysis and respiration.
25045415 The present study shows low circulating levels of SIRT4 in obese patients with nonalcoholic fatty liver disease.
More...

AA Sequence

MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESG      1 - 70
IPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWL     71 - 140
VTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEE    141 - 210
QVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKL    211 - 280
PIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC                                        281 - 314
//

Text Mined References (30)

PMID Year Title
26775843 2016 SIRT4 regulates cancer cell survival and growth after stress.
26086877 2015 Tumour-suppressive function of SIRT4 in human colorectal cancer.
26054687 2015 Sirtuin-4 (SIRT4) is downregulated and associated with some clinicopathological features in gastric adenocarcinoma.
25633289 2015 CtBP maintains cancer cell growth and metabolic homeostasis via regulating SIRT4.
25525879 2014 Sirtuin 4 is a lipoamidase regulating pyruvate dehydrogenase complex activity.
25466907 2015 Preliminary data on the relationship between circulating levels of Sirtuin 4, anthropometric and metabolic parameters in obese subjects according to growth hormone/insulin-like growth factor-1 status.
25361925 2014 Direct evidence of sirtuin downregulation in the liver of non-alcoholic fatty liver disease patients.
25331589 2015 SIRT4 Suppresses Inflammatory Responses in Human Umbilical Vein Endothelial Cells.
25165814 2014 Overexpression of mitochondrial sirtuins alters glycolysis and mitochondrial function in HEK293 cells.
25045415 2014 Circulating levels of sirtuin 4, a potential marker of oxidative metabolism, related to coronary artery disease in obese patients suffering from NAFLD, with normal or slightly increased liver enzymes.
More...